DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and mpdu1a

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001004545.1 Gene:mpdu1a / 447806 ZFINID:ZDB-GENE-040912-9 Length:258 Species:Danio rerio


Alignment Length:219 Identity:36/219 - (16%)
Similarity:90/219 - (41%) Gaps:27/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVVADLLSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYM 83
            :|::..:.:..:...::..:|||..|....||.|:.:..:.|:|.:.:...::.||..:...::.
Zfish    44 IVLSKTMGIFILMGIVIAPLPQICKILWCGSSYGLCLTSVFLDLMAISTHAAFCYTQNFPIGAWG 108

  Fly    84 E--YPVLLLQEYALIYYAFKYQDLLGRRTQVVAILYSIVATLIYMKLFPIIILKFLVPFCTPIGA 146
            |  :.|:.:...||:.:..:.:.:.|   ..:..|:..|..|:...|.|:.::..|..:......
Zfish   109 ESLFAVIQIALLALLIHHHEGKTIKG---IFLLALFCGVMFLLASPLTPVAVVWTLYEWNVLFVV 170

  Fly   147 TSKVLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVF------FQSH--------DWMLLSNF 197
            .|:..|:::..|......:|..:..|....::.|:::..      |.:.        .|::|:..
Zfish   171 ASRFFQVVSNFRCGHTGQLSILSVFLVFLGSLGRVFSSLQDTGFSFSAQMQTLACCCSWLILAQI 235

  Fly   198 LISTFLSASVFTAACVYKKKAKAE 221
            |        ::...|....|.:|:
Zfish   236 L--------MYWNKCTTNSKKEAQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 11/57 (19%)
mpdu1aNP_001004545.1 2A43 44..239 CDD:130026 33/205 (16%)
PQ-loop 47..104 CDD:282099 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.