DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and CG3792

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster


Alignment Length:193 Identity:49/193 - (25%)
Similarity:97/193 - (50%) Gaps:8/193 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL 89
            |.|..::..:::||||:..|..::|.:||:::|:.|:|.:.:..||||:..||.|.::.:...|.
  Fly    41 LGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLA 105

  Fly    90 LQEYALIYYAFKYQDLLGRRTQ--VVAILYSIVATLIYMKLFPIIILKFLVPFCT-PIGATSKVL 151
            :|...:......:.   ||:.|  :..:.|.::..::...|.|:.:| |.:..|. ||....|:.
  Fly   106 IQTVTIAVLVLFFN---GRKAQSGLFLVGYVVLMYVLNSGLTPMSVL-FTIQSCNIPILLVGKLS 166

  Fly   152 QLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVY 214
            |.....:......:|..|..:....::.||:|...::.|:|::..|:.|||.: ||.....:|
  Fly   167 QAYTNYQAGSTGQLSAATVIMMFAGSVARIFTSIQETGDFMIILTFIASTFAN-SVILGQLIY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 19/54 (35%)
CG3792NP_608889.1 2A43 36..230 CDD:130026 49/193 (25%)
PQ-loop 38..96 CDD:282099 19/54 (35%)
CTNS 162..193 CDD:128923 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467096
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.