DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and Mpdu1

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001100481.1 Gene:Mpdu1 / 303244 RGDID:1307699 Length:247 Species:Rattus norvegicus


Alignment Length:198 Identity:48/198 - (24%)
Similarity:92/198 - (46%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL 89
            |.|..|:..|::|:|||..:...:|::|:|:..:.|||.:.|..:.|:.|:.:.|.|:.|...|.
  Rat    46 LGLGIVAGSLLVKLPQIFKLLGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLT 110

  Fly    90 LQEYALIYYAFKYQDLLGRRTQVVAIL--YSIVATLIYMKLFPIIILKFLVPFCTPIGATSKVLQ 152
            ||...:.:....|:   |...:.||.|  :::|...:...:.|:.:...|.....|.....|:||
  Rat   111 LQTVTICFLVMHYR---GETVKGVAFLVCFAVVLLALLSPVMPLAVPTLLQASNVPAVVVGKLLQ 172

  Fly   153 LLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVYKKK 217
            ............:|..|..:....::.||:|...::.|.::...|::|: |...:..|..::...
  Rat   173 AATNYHNGHTGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSS-LCNGLIAAQVLFYWN 236

  Fly   218 AKA 220
            |||
  Rat   237 AKA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 17/54 (31%)
Mpdu1NP_001100481.1 2A43 40..235 CDD:130026 45/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.