Sequence 1: | NP_647878.1 | Gene: | CG1265 / 38517 | FlyBaseID: | FBgn0035517 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036030.2 | Gene: | Mpdu1 / 24070 | MGIID: | 1346040 | Length: | 247 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 51/198 - (25%) |
---|---|---|---|
Similarity: | 95/198 - (47%) | Gaps: | 6/198 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL 89
Fly 90 LQEYALIYYAFKYQDLLGRRTQVVAIL--YSIVATLIYMKLFPIIILKFLVPFCTPIGATSKVLQ 152
Fly 153 LLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVYKKK 217
Fly 218 AKA 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1265 | NP_647878.1 | PQ-loop | 22..80 | CDD:282099 | 16/54 (30%) |
Mpdu1 | NP_036030.2 | 2A43 | 40..235 | CDD:130026 | 48/192 (25%) |
PQ-loop | 43..101 | CDD:282099 | 16/54 (30%) | ||
CTNS | 167..198 | CDD:128923 | 6/30 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3211 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |