DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and Mpdu1

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_036030.2 Gene:Mpdu1 / 24070 MGIID:1346040 Length:247 Species:Mus musculus


Alignment Length:198 Identity:51/198 - (25%)
Similarity:95/198 - (47%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLL 89
            |.|..|:..|::|:||:..:...:|::|:|:..:.|||.:.|..:.|:.|:.:.|.|:.|...|.
Mouse    46 LGLGIVAGSLLVKLPQVFKLLGAKSAEGLSLQSVMLELVALTGTVVYSITNNFPFSSWGEALFLT 110

  Fly    90 LQEYALIYYAFKYQDLLGRRTQVVAIL--YSIVATLIYMKLFPIIILKFLVPFCTPIGATSKVLQ 152
            ||..|:.:....|:   |...:.||.|  |::|...:...|.|:.::..|.....|.....|:||
Mouse   111 LQTVAICFLVMHYR---GETVKGVAFLACYAMVLLALLSPLTPLAVVTLLQASNVPAVVVGKLLQ 172

  Fly   153 LLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVYKKK 217
            .....|......:|..|..:....::.||:|...::.|.::...|::|: |...:..|..::...
Mouse   173 AATNYRNGHTGQLSAITVFMLFGGSLARIFTSVQETGDPLMAGVFVVSS-LCNGLIAAQVLFYWN 236

  Fly   218 AKA 220
            |||
Mouse   237 AKA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 16/54 (30%)
Mpdu1NP_036030.2 2A43 40..235 CDD:130026 48/192 (25%)
PQ-loop 43..101 CDD:282099 16/54 (30%)
CTNS 167..198 CDD:128923 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.