DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and Pqlc3

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_766162.2 Gene:Pqlc3 / 217430 MGIID:2444067 Length:202 Species:Mus musculus


Alignment Length:194 Identity:66/194 - (34%)
Similarity:100/194 - (51%) Gaps:5/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYMEYPVLLLQEY 93
            |:..|..:|:|||....|..|::|||:..|.|||..:.|.|.|.:..|...|:|:|||:|:.|:.
Mouse    13 TLGVCAALKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYGNPLLTYLEYPILIAQDI 77

  Fly    94 ALIYYAFKYQDLLGRRTQVVAILYSIVATLIYMKLFPIIILKFLVPFCTPIGATSKVLQLLAILR 158
            .|:.:.|.:...:.:....:|:..|....|...|.    |:...:..||.|.|.||..||..:.:
Mouse    78 VLLLFVFHFNGNVKQALPYMAVFVSSWFILSLQKW----IIDLAMNLCTVISAASKFAQLQYLWK 138

  Fly   159 TKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACVYKKKA-KAE 221
            .:|:.:||..||.|||:|..|||.|....::|..:|..|:|...|:..|......|:|.| |||
Mouse   139 VQDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILIRFVIMLALNIWVTATVLHYRKSATKAE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 19/50 (38%)
Pqlc3NP_766162.2 PQ-loop 5..>53 CDD:367864 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848200
Domainoid 1 1.000 74 1.000 Domainoid score I9140
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16454
Inparanoid 1 1.050 106 1.000 Inparanoid score I4919
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47627
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 1 1.000 - - FOG0008406
OrthoInspector 1 1.000 - - oto92438
orthoMCL 1 0.900 - - OOG6_110752
Panther 1 1.100 - - LDO PTHR12226
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5753
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.