DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and mpdu-1

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_505155.2 Gene:mpdu-1 / 179218 WormBaseID:WBGene00018181 Length:242 Species:Caenorhabditis elegans


Alignment Length:207 Identity:54/207 - (26%)
Similarity:91/207 - (43%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ITVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSY-------MEY 85
            ||:.|.|:. ||||..|:|..|::|||.....|.|.......||:|.||:.|..:       ::.
 Worm    45 ITLGSILLF-VPQILKIQAARSAQGISAASQLLALVGAIGTASYSYRSGFVFSGWGDSFFVAVQL 108

  Fly    86 PVLLLQEYALIYYAFKYQDLL--GRRTQVVAILYSIVATLIYMKLFPIIILKFLVPFCTPIGATS 148
            .:::||     .:.|..|.:|  |....|.|:.|.:|:     |..|:..|..:.....||...|
 Worm   109 VIIILQ-----IFLFSGQTMLSVGFLGIVSAVAYGVVS-----KSIPMQTLTAVQTAGIPIVVVS 163

  Fly   149 KVLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACV 213
            |:||:....|.:....:|..:..|.....:.|::|....:.|.:|:.::..:..|:..:|....:
 Worm   164 KLLQISQNYRAQSTGQLSLISVFLQFAGTLARVFTSVQDTGDMLLIVSYSTAAVLNGLIFAQFFM 228

  Fly   214 Y--------KKK 217
            |        |||
 Worm   229 YWSHSESAAKKK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 21/51 (41%)
mpdu-1NP_505155.2 2A43 36..230 CDD:130026 50/195 (26%)
PQ-loop 38..96 CDD:282099 21/51 (41%)
CTNS 162..193 CDD:128923 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.