DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1265 and SLC66A3

DIOPT Version :9

Sequence 1:NP_647878.1 Gene:CG1265 / 38517 FlyBaseID:FBgn0035517 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_689604.1 Gene:SLC66A3 / 130814 HGNCID:28503 Length:202 Species:Homo sapiens


Alignment Length:204 Identity:72/204 - (35%)
Similarity:110/204 - (53%) Gaps:8/204 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ADLLSLI---TVSSCLVIKVPQINTIRANESSKGISVLGLCLELFSYTVMLSYNYTSGYDFLSYM 83
            |.||.|.   |:..|..:|:|||:.:.|..|::|:|:..|.|||..:.|.|.|....||..|:|:
Human     3 AALLGLCNWSTLGVCAALKLPQISAVLAARSARGLSLPSLLLELAGFLVFLRYQCYYGYPPLTYL 67

  Fly    84 EYPVLLLQEYALIYYAFKYQDLLGRRTQVVAILYSIVATLIYMKLFPIIILKFLVPFCTPIGATS 148
            |||:|:.|:..|:...|.:...:.:.|..:|:|.|....|...|.    |:...:..||.|.|.|
Human    68 EYPILIAQDVILLLCIFHFNGNVKQATPYIAVLVSSWFILALQKW----IIDLAMNLCTFISAAS 128

  Fly   149 KVLQLLAILRTKDASSVSRTTWALSAFTNMTRIYTVFFQSHDWMLLSNFLISTFLSASVFTAACV 213
            |..||..:.:|:|:.:||..||:||::|..|||.|....::|:.:|..|:|...|:..|......
Human   129 KFAQLQCLWKTRDSGTVSALTWSLSSYTCATRIITTLMTTNDFTILLRFVIMLALNIWVTVTVLR 193

  Fly   214 YKKKA-KAE 221
            |:|.| |||
Human   194 YRKTAIKAE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1265NP_647878.1 PQ-loop 22..80 CDD:282099 23/60 (38%)
SLC66A3NP_689604.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157813
Domainoid 1 1.000 78 1.000 Domainoid score I8837
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16454
Inparanoid 1 1.050 114 1.000 Inparanoid score I4845
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47627
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 1 1.000 - - FOG0008406
OrthoInspector 1 1.000 - - oto88873
orthoMCL 1 0.900 - - OOG6_110752
Panther 1 1.100 - - LDO PTHR12226
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5753
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.