DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and RRT13

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_010988.1 Gene:RRT13 / 856796 SGDID:S000000868 Length:185 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:58/203 - (28%)
Similarity:92/203 - (45%) Gaps:52/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1146 ECLHTLQGHTNRVYSLQFDGLH----VVSGSLDTSIRVWDVE----TGNCK-------------- 1188
            :||:.|.|||:|:||..:|  |    .:|.|:||:||:||:|    .|.|.              
Yeast     2 KCLYILSGHTDRIYSTIYD--HERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILG 64

  Fly  1189 --HTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTGQCLQTLSGPNKHH------SAVTCLQ 1245
              :||.||::|...:.|....|||.:.|.:::.||..|...        ||.      :.:|.|.
Yeast    65 AMYTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFL--------KHFFDHTQLNTITALH 121

  Fly  1246 FNSRFVVTSSDDGTVKLWDVKTGDFIRNLVALDSGGSGGVVWRIRANDTKLICAV--GSRNGTEE 1308
            .:.. |:.|..:|.:.::|:.:|..:|:    |:......||.:...|..|:.||  ..||    
Yeast   122 VSDE-VLVSGSEGLLNIYDLNSGLLVRS----DTLSGADNVWNVSFKDNTLVAAVERDKRN---- 177

  Fly  1309 TKLMVLDF 1316
             .|.:|||
Yeast   178 -LLEILDF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689
WD40 <981..1274 CDD:225201 45/157 (29%)
WD40 988..1264 CDD:238121 42/147 (29%)
WD40 repeat 998..1033 CDD:293791
WD40 repeat 1039..1073 CDD:293791
WD40 repeat 1078..1112 CDD:293791
WD40 repeat 1119..1152 CDD:293791 2/5 (40%)
WD40 repeat 1158..1192 CDD:293791 16/57 (28%)
WD40 repeat 1200..1232 CDD:293791 8/31 (26%)
WD40 repeat 1241..1263 CDD:293791 5/21 (24%)
RRT13NP_010988.1 WD40 <2..175 CDD:421866 52/187 (28%)
WD40 repeat 15..71 CDD:293791 17/57 (30%)
WD40 repeat 76..110 CDD:293791 10/41 (24%)
WD40 repeat 118..150 CDD:293791 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1561
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002731
OrthoInspector 1 1.000 - - otm46926
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.