DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and fbxo16

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_001017680.1 Gene:fbxo16 / 550375 ZFINID:ZDB-GENE-041015-747 Length:348 Species:Danio rerio


Alignment Length:263 Identity:61/263 - (23%)
Similarity:110/263 - (41%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   845 LQHWLAQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIE---PQFQRDFISLLPRELALFVLSY 906
            |..|   |::|:..:|...|......|...|::|:.:.:.   |:...||.::|||.::|::.||
Zfish    28 LGKW---FEKWTDSQRKQVLQDFFSRCSAGQLKHLRQTLSSWVPEETLDFTTVLPRVISLYIFSY 89

  Fly   907 LEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQ--ILAEPRSDRPKRGRDGNMPPIASPWKAAY 969
            |:|:.|.|.||....|:.|.:.:.||..||.|..  |...|            .|.....||..|
Zfish    90 LDPRSLCRCAQVSWHWKNLAELDQLWMPKCLKLGWCITFTP------------TPFEQGVWKRQY 142

  Fly   970 MRQHIIEMNWRSRPVRKPKV-LKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLRTLVG 1033
            : :.:.|::     :.:||| :|  ::.::..:     :::....:.:|            .|.|
Zfish   143 I-ETVQELH-----ISRPKVPVK--EEFIVPDV-----KVIGSETEGSL------------PLTG 182

  Fly  1034 HTG--GVWSSQMSGNIIISGSTDRTLKVW-DMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDA 1095
            |..  |:.....:||.:  |.:.:.|..| |.|        :..|.|:|..:|........:|.|
Zfish   183 HRDLLGLQGRSKNGNDL--GKSAKGLPPWRDSD--------RHPTDTIRFNYLDNLHPGEHARKA 237

  Fly  1096 TLR 1098
            .|:
Zfish   238 LLK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 18/45 (40%)
WD40 <981..1274 CDD:225201 23/122 (19%)
WD40 988..1264 CDD:238121 22/115 (19%)
WD40 repeat 998..1033 CDD:293791 2/34 (6%)
WD40 repeat 1039..1073 CDD:293791 7/34 (21%)
WD40 repeat 1078..1112 CDD:293791 5/21 (24%)
WD40 repeat 1119..1152 CDD:293791
WD40 repeat 1158..1192 CDD:293791
WD40 repeat 1200..1232 CDD:293791
WD40 repeat 1241..1263 CDD:293791
fbxo16NP_001017680.1 F-box-like 78..121 CDD:289689 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.