DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and CDRT1

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_006373.2 Gene:CDRT1 / 374286 HGNCID:14379 Length:752 Species:Homo sapiens


Alignment Length:489 Identity:115/489 - (23%)
Similarity:191/489 - (39%) Gaps:94/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 SVTPSSHLTSSTPGSALGRRTPRSVPSRDNPPPELQHWLAQF----QRWSHVERLLA-LDRLI-- 868
            |.|...:.|:.|..::|    |.|      ..||.:|:|...    :.|.:..|.:: ::||.  
Human   189 SATSQVYWTAKTQHTSL----PLS------KAPENEHFLGAASNPEEPWRNSLRCISEMNRLFSG 243

  Fly   869 ---------DHC----DPSQVRHMMKVIEPQFQRDFISLLPRELALFVLSYLEPKDLLRAAQTCR 920
                     |.|    |...:|.:......  .||||..||..|:.::|..|:...|.:.|...:
Human   244 KADITKPGYDPCNLLVDLDDIRDLSSGFSK--YRDFIRYLPIHLSKYILRMLDRHTLNKCASVSQ 306

  Fly   921 SWRFLC----------------------------DDNLLWKEKCRKAQILAEPRSDRPKRGRDGN 957
            .|..:.                            |.|.     ..|..|..      ||...||.
Human   307 HWAAMAQQVKMDLSAHGFIQNQITFLQGSYTRGIDPNY-----ANKVSIPV------PKMVDDGK 360

  Fly   958 MPPIASP-WK----------AAYMRQHIIEMNWRSRPV----RKPKVLKGHDDHVITCLQFSGNR 1007
            ...:..| ||          .||..:...::....|.|    ...::|....|. ...:.:||..
Human   361 SMRVKHPKWKLRTKNEYNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQ-NRVIHYSGGD 424

  Fly  1008 IVSGSDDNTLKVWSAVNGKCLRT-LVGHTGGVWSSQM--SGNIIISGSTDRTLKVWDMDSGACVH 1069
            :::.|.:..:.:...:..|.:.. ..||.|.|.:..:  ..|.::|||.|.:::.||:.||.|..
Human   425 LIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWDLKSGVCTR 489

  Fly  1070 TLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYD 1134
            ...||..|:.||.|..:::|||.||..::|||::.|.||... .|...:...:.:...|||....
Human   490 IFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTF-RHKDPILATRINDTYIVSSCER 553

  Fly  1135 YMVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMG--HQSL 1197
            .:||:||....:.:.||.||...|..|.||..|::|||.|..:..|.: .|..:..||.  |...
Human   554 GLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWSM-VGKYERCLMAFKHPKE 617

  Fly  1198 TSGMELRQNILVSGNADSTVKVWDITTGQCLQTL 1231
            ...:.|....::|..||..:::::...|.|::.:
Human   618 VLDVSLLFLRVISACADGKIRIYNFFNGNCMKVI 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 11/73 (15%)
WD40 <981..1274 CDD:225201 71/260 (27%)
WD40 988..1264 CDD:238121 69/249 (28%)
WD40 repeat 998..1033 CDD:293791 4/35 (11%)
WD40 repeat 1039..1073 CDD:293791 10/35 (29%)
WD40 repeat 1078..1112 CDD:293791 14/33 (42%)
WD40 repeat 1119..1152 CDD:293791 8/32 (25%)
WD40 repeat 1158..1192 CDD:293791 11/33 (33%)
WD40 repeat 1200..1232 CDD:293791 6/32 (19%)
WD40 repeat 1241..1263 CDD:293791
CDRT1NP_006373.2 WD 1 169..206 5/20 (25%)
WD 2 409..447 5/38 (13%)
WD40 <416..673 CDD:225201 67/238 (28%)
WD40 418..653 CDD:238121 67/236 (28%)
WD 3 451..490 14/38 (37%)
WD40 repeat 457..493 CDD:293791 10/35 (29%)
WD 4 493..532 17/39 (44%)
WD40 repeat 498..532 CDD:293791 14/34 (41%)
WD 5 534..569 7/34 (21%)
WD40 repeat 538..571 CDD:293791 8/32 (25%)
WD 6 572..609 13/37 (35%)
WD40 repeat 577..613 CDD:293791 13/36 (36%)
WD 7 611..652 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.