DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ago and ECT2L

DIOPT Version :9

Sequence 1:	NP_523922.1	Gene:	ago / 38516	FlyBaseID:	FBgn0041171	Length:	1326	Species:	Drosophila melanogaster
Sequence 2:	XP_006715535.1	Gene:	ECT2L / 345930	HGNCID:	21118	Length:	946	Species:	Homo sapiens

Alignment Length:	97	Identity:	34/97 - (35%)
Similarity:	52/97 - (53%)	Gaps:	6/97 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   845 LQHWLAQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEPQFQ---RDFISLLPRELALFVLSY 906
            :.||   |..|::.:|...|..:...|..||:|.:......:.|   .||.::|||.::|::.|:
Human    31 ISHW---FDLWTNKQRQEFLFAIFLRCTKSQLRFVQDWFSERMQVAKVDFSTVLPRFISLYIFSF 92

  Fly   907 LEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRK 938
            |.||||..|||....|:||.:.:.||..||.|
Human    93 LSPKDLCAAAQVSWPWKFLTEQDCLWMPKCVK 124

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ago	NP_523922.1	F-box-like	892..938	CDD:289689	20/45 (44%)
		WD40	<981..1274	CDD:225201
		WD40	988..1264	CDD:238121
		WD40 repeat	998..1033	CDD:293791
		WD40 repeat	1039..1073	CDD:293791
		WD40 repeat	1078..1112	CDD:293791
		WD40 repeat	1119..1152	CDD:293791
		WD40 repeat	1158..1192	CDD:293791
		WD40 repeat	1200..1232	CDD:293791
		WD40 repeat	1241..1263	CDD:293791
ECT2L	XP_006715535.1	F-box-like	81..118	CDD:289689	16/36 (44%)
		DUF4347	292..459	CDD:290951
		RhoGEF	612..795	CDD:279015
		PH-like	<852..946	CDD:302622
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0274
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900