DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and Wdr86

DIOPT Version :10

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_001382565.1 Gene:Wdr86 / 311956 RGDID:1566180 Length:380 Species:Rattus norvegicus


Alignment Length:336 Identity:99/336 - (29%)
Similarity:149/336 - (44%) Gaps:58/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   988 KVLKGHDDHVITCLQFS--GNRIVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGNIIIS 1050
            :|..||... |..|..|  |.|:::||:|.|.::||.|:|:|...|.||...|...|:......:
  Rat     9 RVCAGHRGG-INWLSLSPDGQRLLTGSEDGTARLWSTVDGQCCALLQGHESYVTFCQLEDETAFT 72

  Fly  1051 GSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHL 1115
            .|.|.|::.||:.:|.|:...:||||.|..:.:...::.|.|.|.|.|||.:::|.......||.
  Rat    73 CSADCTIRSWDVRTGQCLQVYRGHTSIVNRILVANDQLFSSSYDRTARVWTVDKGQMSQEFRGHR 137

  Fly  1116 AAVRCVQYD----------------GKLIVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFD 1164
            ..|..:.|.                |.|:|:|:.|...|:|......|..||:|||..|..|..|
  Rat   138 NCVLTLAYSAPKDLPRDPCLEAAMGGGLLVTGSSDDTAKVWQVASGCCHQTLRGHTGAVLCLVLD 202

  Fly  1165 -GLHVV-SGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADSTVKVWDITTGQC 1227
             ..|.. :||.|.::|.||:.:|........||.....:||...:|.||:||.|||.|...||:.
  Rat   203 VSSHTAFTGSTDATVRAWDILSGEQLRVFREHQGSVICLELTDRLLYSGSADRTVKCWLADTGER 267

  Fly  1228 LQTLSGPN------KHHS-------------------------------AVTCLQFNSRFVVTSS 1255
            :.|.|...      |:|:                               .:.|||.:.:.:.|:|
  Rat   268 VCTFSAHRHSVSALKYHAGTLFTGSGDACARAFDAQSGVLQRVFRGHTFVINCLQVHGQVLYTAS 332

  Fly  1256 DDGTVKLWDVK 1266
            .||.::.|||:
  Rat   333 HDGALRFWDVR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box_FBXW7 875..933 CDD:438905
WD40 <979..1267 CDD:441893 99/336 (29%)
WD40 repeat 998..1033 CDD:293791 15/36 (42%)
WD40 repeat 1039..1073 CDD:293791 8/33 (24%)
WD40 repeat 1078..1112 CDD:293791 9/33 (27%)
WD40 repeat 1119..1152 CDD:293791 10/48 (21%)
WD40 repeat 1158..1192 CDD:293791 11/35 (31%)
WD40 repeat 1200..1232 CDD:293791 14/31 (45%)
WD40 repeat 1241..1263 CDD:293791 7/21 (33%)
Wdr86NP_001382565.1 WD40 4..344 CDD:441893 99/336 (29%)
WD40 repeat 19..55 CDD:293791 14/35 (40%)
WD40 repeat 101..135 CDD:293791 8/33 (24%)
WD40 repeat 140..190 CDD:293791 11/49 (22%)
WD40 repeat 197..232 CDD:293791 10/34 (29%)
WD40 repeat 239..272 CDD:293791 14/32 (44%)
WD40 repeat 278..312 CDD:293791 2/33 (6%)
WD40 repeat 318..340 CDD:293791 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.