DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and FBXW2

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_001362819.1 Gene:FBXW2 / 26190 HGNCID:13608 Length:486 Species:Homo sapiens


Alignment Length:464 Identity:119/464 - (25%)
Similarity:190/464 - (40%) Gaps:120/464 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   844 ELQHWL----AQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEPQFQRDFISLLPRELALFVL 904
            :.:.||    ..|...:.:::...||.||......|:||:...:|...:|||:.|||.||:.::|
Human    37 DFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLL 101

  Fly   905 SYLEPKDLLRAAQTCRSWRFL---CDDNLLWKEKCRKA--QILAEPRSDRPKRGRDGNMPPIASP 964
            .:|:|:.||......:.|..:   |.:  :|:..|:..  ||             |.::.. |..
Human   102 KWLDPQTLLTCCLVSKQWNKVISACTE--VWQTACKNLGWQI-------------DDSVQD-ALH 150

  Fly   965 WKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSAVNGKCLR 1029
            ||..|::. |:.|          |.|:.|:....:                              
Human   151 WKKVYLKA-ILRM----------KQLEDHEAFETS------------------------------ 174

  Fly  1030 TLVGHTGGVWSSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTVRCMHLHGSKVVSGSRD 1094
            :|:||:..|::......::.:||.|.:.|:||:.:|.||:.:|.||..  .:.....|:|:||.|
Human   175 SLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCA--AVKFDEQKLVTGSFD 237

  Fly  1095 ATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKL--IVSGAYDYMVKIWHPERQECLHTLQGHTNR 1157
            .|:..|:...|:......||..||..|.|:.:|  :|||:.|:.||:|......||:||.|||..
Human   238 NTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEW 302

  Fly  1158 VYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQNILVSGNADS-TVKVWD 1221
            |..                     |....||...:.|..       ...||:|  ||. .:|:|.
Human   303 VTK---------------------VVLQKCKVKSLLHSP-------GDYILLS--ADKYEIKIWP 337

  Fly  1222 I---TTGQCLQTLSGPNKHHSAVTCLQ----FNSRFVVTSSDDGTVKLWDVKTGDFIR------- 1272
            |   ...:||:|||   .......|||    |:.:::|.||..|..: ||..:.|.:|       
Human   338 IGREINCKCLKTLS---VSEDRSICLQPRLHFDGKYIVCSSALGLYQ-WDFASYDILRVIKTPEI 398

  Fly  1273 -NLVALDSG 1280
             ||..|..|
Human   399 ANLALLGFG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 14/48 (29%)
WD40 <981..1274 CDD:225201 78/310 (25%)
WD40 988..1264 CDD:238121 74/285 (26%)
WD40 repeat 998..1033 CDD:293791 1/34 (3%)
WD40 repeat 1039..1073 CDD:293791 9/33 (27%)
WD40 repeat 1078..1112 CDD:293791 8/33 (24%)
WD40 repeat 1119..1152 CDD:293791 13/34 (38%)
WD40 repeat 1158..1192 CDD:293791 4/33 (12%)
WD40 repeat 1200..1232 CDD:293791 11/35 (31%)
WD40 repeat 1241..1263 CDD:293791 8/25 (32%)
FBXW2NP_001362819.1 FBOX 92..126 CDD:197608 10/33 (30%)
WD40 172..479 CDD:238121 79/302 (26%)
WD40 repeat 183..217 CDD:293791 10/33 (30%)
WD40 repeat 220..255 CDD:293791 9/36 (25%)
WD40 repeat 261..297 CDD:293791 14/35 (40%)
WD40 repeat 313..351 CDD:293791 12/46 (26%)
WD40 repeat 359..394 CDD:293791 12/35 (34%)
WD40 repeat 409..449 CDD:293791
WD40 repeat 455..477 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.