DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and mec-15

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_496207.1 Gene:mec-15 / 174587 WormBaseID:WBGene00003177 Length:406 Species:Caenorhabditis elegans


Alignment Length:360 Identity:74/360 - (20%)
Similarity:129/360 - (35%) Gaps:71/360 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   895 LPRELALFVLSYLEPKDLL-RAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNM 958
            ||.||...:.:||..:.|: .....||.:..:.:|:..|..:.|..|.:..|..:...       
 Worm    12 LPSELLCHLFTYLPQRQLITEIPLVCRRFNTILNDDKFWSRRIRTEQKVRLPDCELKH------- 69

  Fly   959 PPIASPWKAAYMRQHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNR---IVSGSDDNTLKVW 1020
             |...|.|:.| ..|.....||:...:......||...|.:.:.|..|.   .:|||.|.|:::|
 Worm    70 -PEYEPKKSFY-AMHRQRDRWRAWETQTVITAPGHSATVDSVMLFENNNKQFCLSGSRDRTIRLW 132

  Fly  1021 SAVNGK-----------CLRTLVGHTGGVW--SSQMSGNIIISGSTDRTLKVWDMDSGACVHTLQ 1072
            |..|.:           ..:....|:|.:|  :.:.:.....:.|.|.|:|.|.:.....:..|.
 Worm   133 SIENARNGEDTEQNPWTVAKDDTAHSGWIWNMAQESTSTNFYTTSWDSTVKSWHITDNGALQNLN 197

  Fly  1073 GHT--STVRCMHLHGSKVVSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGKLIVSGAYDY 1135
            ...  |..:|:                        ||    .|:...|.|..:..::.|..:..:
 Worm   198 SVNVGSAAQCI------------------------SC----SGNENEVVCTTFAKRVAVIDSRTF 234

  Fly  1136 MVKIWHPERQECLHTLQGHTNRVYSLQFDGLHVVSGSLDTSIRVWDVETGNCKHTLMGHQSLT-- 1198
            .|...|          :.|...|.:|...|..:.:...|..:.:  |:..|....::...|.|  
 Worm   235 QVVADH----------KLHKRAVIALAVQGDKIFTSGEDRLMMM--VDRRNFSKPVLFEYSPTAY 287

  Fly  1199 -SGMELRQNILVSGNADSTVKVWDITTGQCLQTLS 1232
             |.:.|:.|.|::..:|..||::|......|||.|
 Worm   288 KSCLSLQCNQLLTSTSDGKVKLYDANNFNVLQTYS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 11/43 (26%)
WD40 <981..1274 CDD:225201 53/273 (19%)
WD40 988..1264 CDD:238121 53/266 (20%)
WD40 repeat 998..1033 CDD:293791 10/48 (21%)
WD40 repeat 1039..1073 CDD:293791 7/35 (20%)
WD40 repeat 1078..1112 CDD:293791 3/33 (9%)
WD40 repeat 1119..1152 CDD:293791 4/32 (13%)
WD40 repeat 1158..1192 CDD:293791 6/33 (18%)
WD40 repeat 1200..1232 CDD:293791 10/31 (32%)
WD40 repeat 1241..1263 CDD:293791
mec-15NP_496207.1 F-box-like 9..52 CDD:315592 11/39 (28%)
WD40 88..322 CDD:330360 54/273 (20%)
WD40 repeat 106..154 CDD:293791 11/47 (23%)
WD40 repeat 162..197 CDD:293791 6/34 (18%)
WD40 repeat 204..241 CDD:293791 9/74 (12%)
WD40 repeat 247..286 CDD:293791 7/40 (18%)
WD40 repeat 290..310 CDD:293791 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.