DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and FBXO16

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:NP_758954.1 Gene:FBXO16 / 157574 HGNCID:13618 Length:292 Species:Homo sapiens


Alignment Length:181 Identity:49/181 - (27%)
Similarity:80/181 - (44%) Gaps:27/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   845 LQHWLAQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIE---PQFQRDFISLLPRELALFVLSY 906
            |..|   |.:|:..:|...|..|::.|..||.:...:.::   |....||.:.|||.|:|::.|:
Human    42 LGKW---FDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSF 103

  Fly   907 LEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDRPKRGRDGNMPPIASPWKAAYMR 971
            |:|:.|.|.||.|..|:.|.:.:.||..||.:.....             |..|  :|::....:
Human   104 LDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYI-------------NFSP--TPFEQGIWK 153

  Fly   972 QHIIEMNWRSRPVRKPKVLKGHDDHVITCLQFSGNRIVSGSDDNTLKVWSA 1022
            :|.|:| .:...:.|||. ...|..||..:|.    :.|.|.:......||
Human   154 KHYIQM-VKELHITKPKT-PPKDGFVIADVQL----VTSNSPEEKQSPLSA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 19/45 (42%)
WD40 <981..1274 CDD:225201 11/42 (26%)
WD40 988..1264 CDD:238121 9/35 (26%)
WD40 repeat 998..1033 CDD:293791 6/25 (24%)
WD40 repeat 1039..1073 CDD:293791
WD40 repeat 1078..1112 CDD:293791
WD40 repeat 1119..1152 CDD:293791
WD40 repeat 1158..1192 CDD:293791
WD40 repeat 1200..1232 CDD:293791
WD40 repeat 1241..1263 CDD:293791
FBXO16NP_758954.1 F-box-like 92..129 CDD:315592 15/36 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..224 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.