DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ago and ect2l

DIOPT Version :9

Sequence 1:NP_523922.1 Gene:ago / 38516 FlyBaseID:FBgn0041171 Length:1326 Species:Drosophila melanogaster
Sequence 2:XP_009291443.1 Gene:ect2l / 100332935 -ID:- Length:981 Species:Danio rerio


Alignment Length:93 Identity:31/93 - (33%)
Similarity:53/93 - (56%) Gaps:6/93 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 HWLAQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIE---PQFQRDFISLLPRELALFVLSYLE 908
            ||   |..|:..:|...:.:|:..|..:|::.....:.   |..:.||.::|||.|:|:::|:|.
Zfish    73 HW---FDLWTDRQRKEFICQLLRRCSKTQLKFTNDCLAQSVPISRMDFTAVLPRLLSLYIMSFLS 134

  Fly   909 PKDLLRAAQTCRSWRFLCDDNLLWKEKC 936
            |:|:..|||.|..|:||.:.:.||..||
Zfish   135 PRDICAAAQVCWHWKFLAEQDCLWSPKC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agoNP_523922.1 F-box-like 892..938 CDD:289689 20/45 (44%)
WD40 <981..1274 CDD:225201
WD40 988..1264 CDD:238121
WD40 repeat 998..1033 CDD:293791
WD40 repeat 1039..1073 CDD:293791
WD40 repeat 1078..1112 CDD:293791
WD40 repeat 1119..1152 CDD:293791
WD40 repeat 1158..1192 CDD:293791
WD40 repeat 1200..1232 CDD:293791
WD40 repeat 1241..1263 CDD:293791
ect2lXP_009291443.1 F-box-like 121..164 CDD:289689 20/42 (48%)
DUF4347 331..>468 CDD:290951
Dpy-30 546..578 CDD:253069
RhoGEF 624..829 CDD:279015
PH-like <893..980 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.