DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ago and Ect2l

DIOPT Version :9

Sequence 1:	NP_523922.1	Gene:	ago / 38516	FlyBaseID:	FBgn0041171	Length:	1326	Species:	Drosophila melanogaster
Sequence 2:	NP_001357920.1	Gene:	Ect2l / 100045792	MGIID:	3641723	Length:	953	Species:	Mus musculus

Alignment Length:	97	Identity:	34/97 - (35%)
Similarity:	53/97 - (54%)	Gaps:	6/97 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   845 LQHWLAQFQRWSHVERLLALDRLIDHCDPSQVRHMMKVIEPQFQ---RDFISLLPRELALFVLSY 906
            :.||   |..|::.:|...|..::..|..||:|.:......:.|   .||.::|||.::|::.|:
Mouse    43 ISHW---FDLWTNKQRREFLFVILSQCSKSQLRFIQDWFSERKQVARVDFSTVLPRFISLYIFSF 104

  Fly   907 LEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRK 938
            |.||||..|||....|:||.:.:.||..||.|
Mouse   105 LNPKDLCAAAQVSWPWKFLTEQDCLWMPKCTK 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ago	NP_523922.1	F-box-like	892..938	CDD:289689	20/45 (44%)
		WD40	<981..1274	CDD:225201
		WD40	988..1264	CDD:238121
		WD40 repeat	998..1033	CDD:293791
		WD40 repeat	1039..1073	CDD:293791
		WD40 repeat	1078..1112	CDD:293791
		WD40 repeat	1119..1152	CDD:293791
		WD40 repeat	1158..1192	CDD:293791
		WD40 repeat	1200..1232	CDD:293791
		WD40 repeat	1241..1263	CDD:293791
Ect2l	NP_001357920.1	F-box-like	93..130	CDD:372399	16/36 (44%)
		DUF4347	298..467	CDD:372982
		RhoGEF	620..802	CDD:366202
		PH-like	832..952	CDD:388408
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0274
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900