DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and Aifm1

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_112646.1 Gene:Aifm1 / 83533 RGDID:620817 Length:612 Species:Rattus norvegicus


Alignment Length:363 Identity:71/363 - (19%)
Similarity:124/363 - (34%) Gaps:125/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LVVGGGTGGCAMAAKLSSR-LGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTK 110
            |::||||...|.|..:.:| .|:..::|.|..:..|.:|..:      |.|..|.    |...||
  Rat   134 LLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLS------KELWFSD----DPNVTK 188

  Fly   111 A----KW-VKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCS 170
            .    :| .||:::.|.|.:..||......|:...:.:.||.::.:..:.|.:..|         
  Rat   189 TLQFRQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVHLDVRGNMVKL--------- 244

  Fly   171 IYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQKIAYISE---------HYFRKMG---- 222
                             |.|:.| ||..|.|...|.|:.::.|..         ..|||:|    
  Rat   245 -----------------NDGSQI-TFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRA 291

  Fly   223 ----RRD--NVNII----YNTSLPVIFGVKHYAEAL------------------------MKLIK 253
                .|:  ::.:|    ..:.|....|.|..|..:                        |:.:|
  Rat   292 LEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPEYLSNWTMEKVK 356

  Fly   254 RRNI---------TLNVQRNLVEVRHKDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANC 309
            |..:         ::.|....:.::.||...|..|.....|..|              |:|.   
  Rat   357 REGVKVMPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVTAVGLE--------------PNVE--- 404

  Fly   310 KKLVTPTGFVDVD------QLTLQHNKYSNVFAIGDSA 341
               :..||.:::|      ::..:....||::..||:|
  Rat   405 ---LAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 65/351 (19%)
Aifm1NP_112646.1 Mitochondrial localization signal. /evidence=ECO:0000250|UniProtKB:Q9Z0X1 1..30
Mitochondrial localization signal. /evidence=ECO:0000250|UniProtKB:Q9Z0X1 62..88
FAD-dependent oxidoreductase. /evidence=ECO:0000250|UniProtKB:Q9Z0X1 133..482 71/363 (20%)
Pyr_redox_2 149..446 CDD:285266 64/348 (18%)
Pyr_redox 301..385 CDD:278498 10/83 (12%)
Nuclear localization signal. /evidence=ECO:0000255 445..450
AIF_C 464..592 CDD:291391
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 512..551
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.