DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and NDC1

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_568205.6 Gene:NDC1 / 830775 AraportID:AT5G08740 Length:519 Species:Arabidopsis thaliana


Alignment Length:381 Identity:87/381 - (22%)
Similarity:162/381 - (42%) Gaps:84/381 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QVLVVGGGTGGCAMAAKLSSRLGSD----KVVVLEPEDKHYYQPM-FTLIGGGMKRLDQSHRQMA 104
            :|.::|||.||...|.:|.|.:..:    :||:::..::..::|| :.|:.|.:...:.:.| .:
plant    82 RVCILGGGFGGLYTALRLESLVWPEDKKPQVVLVDQSERFVFKPMLYELLSGEVDVWEIAPR-FS 145

  Fly   105 DVLP-TKAKWVKEKALEFDP------DNNTVSTSGGKT-------IKYDFLIIATGLQLNYGKIP 155
            |:|. |..::::::.....|      :.:.:|.:||..       |:||:|::|.|.:.....:|
plant   146 DLLTNTGIQFLRDRVKTLLPCDHLGVNGSEISVTGGTVLLESGFKIEYDWLVLALGAESKLDVVP 210

  Fly   156 GLVEALETPDSNVCSIYSPKYVDHVYECLRRTNK-----GNAIFTFPNCPIKCAGAPQKIAYISE 215
            |.:| |..|      .|:.:....|.|.|.:..:     |:||..   ..:.|..|..::|....
plant   211 GAME-LAFP------FYTLEDAIRVNEKLSKLERKNFKDGSAIKV---AVVGCGYAGVELAATIS 265

  Fly   216 HYFRKMGRRDNVNIIYN--TSLPVIFGVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNIAVFE 278
            ...:..|...::|:..|  ||.|     ....||.||::..|.:.|.:...:..::...|:.  |
plant   266 ERLQDRGIVQSINVSKNILTSAP-----DGNREAAMKVLTSRKVQLLLGYLVQSIKRASNLE--E 323

  Fly   279 DLAKPGVHYEETYSMLHVTP-------PMSTPDVV---ANCKKLVT---PT----------GFVD 320
            |         |.| .|.:.|       .:...|:|   ...|.|:|   |:          |..:
plant   324 D---------EGY-FLELQPAERGLESQIIEADIVLWTVGAKPLLTKLEPSGPNVLPLNARGQAE 378

  Fly   321 VDQLTLQHNKYSNVFAIGDSASSPNSK------TAAAAAAQSPVVFKNVMAAIEGK 370
            .|: ||:...:..:||:|||:|..:|.      ||..|..::.....|:.|||..:
plant   379 TDE-TLRVKGHPRIFALGDSSSLRDSNGKILPTTAQVAFQEADFTGWNIWAAINNR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 72/331 (22%)
NDC1NP_568205.6 Ndh 80..499 CDD:224172 87/381 (23%)
NADB_Rossmann 247..316 CDD:304358 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.