DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and PYROXD1

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_079130.2 Gene:PYROXD1 / 79912 HGNCID:26162 Length:500 Species:Homo sapiens


Alignment Length:407 Identity:71/407 - (17%)
Similarity:131/407 - (32%) Gaps:176/407 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTKA 111
            :|||||..|...|.:|::...|:.::::..      .|:...:        .:.:|::.:|.   
Human    14 VVVGGGIAGVTCAEQLATHFPSEDILLVTA------SPVIKAV--------TNFKQISKILE--- 61

  Fly   112 KWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSPKY 176
                    |||.:..: ||..||... :..:|.:|::    ::......:.|.|.|         
Human    62 --------EFDVEEQS-STMLGKRFP-NIKVIESGVK----QLKSEEHCIVTEDGN--------- 103

  Fly   177 VDHVYE--CLRRTNKGNAIFTFPNCPIKCAGAPQKI-----AYI--------SEHYFRKMGRRDN 226
             .|||:  ||                  ||||..|:     .|:        ::.:.:::.:...
Human   104 -QHVYKKLCL------------------CAGAKPKLICEGNPYVLGIRDTDSAQEFQKQLTKAKR 149

  Fly   227 VNIIYNTSL-----------PVIFGVKH-----------YAEAL-MKLI----------KRRNIT 258
            :.||.|..:           .||:.:|.           .||.| .|||          ||...|
Human   150 IMIIGNGGIALELVYEIEGCEVIWAIKDKAIGNTFFDAGAAEFLTSKLIAEKSEAKIAHKRTRYT 214

  Fly   259 ----------------------------LNVQRNLVEVRHKDNIAVFEDLAKPGVHYEETYSML- 294
                                        ||: :...|..||.::....::.|  ::.::.:.:| 
Human   215 TEGRKKEARSKSKADNVGSALGPDWHEGLNL-KGTKEFSHKIHLETMCEVKK--IYLQDEFRILK 276

  Fly   295 --HVTPPMSTPDVVAN-----------------CKKLVTPTG-------FVDVDQLTL------- 326
              ..|.|.....|.|:                 |..:|:.||       |:..:...|       
Human   277 KKSFTFPRDHKSVTADTEMWPVYVELTNEKIYGCDFIVSATGVTPNVEPFLHGNSFDLGEDGGLK 341

  Fly   327 ----QHNKYSNVFAIGD 339
                .|....:::|.||
Human   342 VDDHMHTSLPDIYAAGD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 65/395 (16%)
PYROXD1NP_079130.2 Pyr_redox_2 24..383 CDD:330998 65/397 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..235 1/23 (4%)
NirB <300..>494 CDD:330997 10/59 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.