Sequence 1: | NP_647877.1 | Gene: | CG14997 / 38514 | FlyBaseID: | FBgn0035515 | Length: | 457 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079130.2 | Gene: | PYROXD1 / 79912 | HGNCID: | 26162 | Length: | 500 | Species: | Homo sapiens |
Alignment Length: | 407 | Identity: | 71/407 - (17%) |
---|---|---|---|
Similarity: | 131/407 - (32%) | Gaps: | 176/407 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 LVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTKA 111
Fly 112 KWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSPKY 176
Fly 177 VDHVYE--CLRRTNKGNAIFTFPNCPIKCAGAPQKI-----AYI--------SEHYFRKMGRRDN 226
Fly 227 VNIIYNTSL-----------PVIFGVKH-----------YAEAL-MKLI----------KRRNIT 258
Fly 259 ----------------------------LNVQRNLVEVRHKDNIAVFEDLAKPGVHYEETYSML- 294
Fly 295 --HVTPPMSTPDVVAN-----------------CKKLVTPTG-------FVDVDQLTL------- 326
Fly 327 ----QHNKYSNVFAIGD 339 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14997 | NP_647877.1 | Pyr_redox_2 | 59..342 | CDD:285266 | 65/395 (16%) |
PYROXD1 | NP_079130.2 | Pyr_redox_2 | 24..383 | CDD:330998 | 65/397 (16%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 211..235 | 1/23 (4%) | |||
NirB | <300..>494 | CDD:330997 | 10/59 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0446 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |