DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and Aifm2

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_722474.2 Gene:Aifm2 / 71361 MGIID:1918611 Length:380 Species:Mus musculus


Alignment Length:402 Identity:83/402 - (20%)
Similarity:151/402 - (37%) Gaps:71/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SRVNRERQECQVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQS 99
            |:|:.:.....|::||||.||.|.|::|.:......:|.::....|....:...:..|..:    
Mouse     3 SQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAK---- 63

  Fly   100 HRQMADVLPT-KAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKIPGLVEALET 163
             :.......| |..:.:.|.:..|..|..|...||:.:.:..||:|||   :.|..||....:..
Mouse    64 -KTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATG---STGPFPGKFNEVSC 124

  Fly   164 PDSNVCSIYSPKYVDHVYECLRR-----TNKGNAIFTFPNCPIKCAGAPQKIAYISEHYFRKMGR 223
            ..:.:     ..|.|.|.:..|.     ...|:|             ..:..|.|...|..|   
Mouse   125 QQAAI-----QAYEDMVKQIQRSQFIVVVGGGSA-------------GVEMAAEIKTEYPEK--- 168

  Fly   224 RDNVNIIYNTSLPVIFGVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNIAVFEDLAKPGVHYE 288
              .|.:|: :.:|:       |:..:....|:.:...:.|..|::...:.::..|:|  |...|.
Mouse   169 --EVTLIH-SRVPL-------ADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEEL--PRNEYR 221

  Fly   289 ETYSMLHV---TPPMSTPDVVANCKKL------------VTPTGFVDVDQLTLQHNKYSNVFAIG 338
            | |..:..   |...:...:|.|..|:            :...|.:.|::. ||...|||::|||
Mouse   222 E-YIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEF-LQVEGYSNIYAIG 284

  Fly   339 DSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGYSSCILAEFDYNLTPV 403
            |.|.:...|.|..|...:.|...|::.::: :.|...|...:..|......:.:|      .||.
Mouse   285 DCADTKEPKMAYHAGLHANVAVANIVNSMK-QRPLKAYKPETDQPPAALSPALLL------WTPA 342

  Fly   404 ETFPLDQSKERY 415
            ....|.:.:..|
Mouse   343 RKLTLSEGRINY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 59/303 (19%)
Aifm2NP_722474.2 Pyr_redox_2 20..302 CDD:285266 67/324 (21%)
TIM_phosphate_binding <268..364 CDD:304361 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.