DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and Aifm3

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_008767097.1 Gene:Aifm3 / 303786 RGDID:1306028 Length:608 Species:Rattus norvegicus


Alignment Length:423 Identity:91/423 - (21%)
Similarity:153/423 - (36%) Gaps:112/423 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 STRFLSTSRVNRERQEC----------QVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKHYY 82
            |.:.|...|..:...:|          .||:||.|..|...|..|.....||: :||...|:|..
  Rat   168 SKQALQLQRRTKVMAKCISPSAGHSSTNVLIVGAGAAGLVCAETLRQEGFSDR-IVLCTLDRHLP 231

  Fly    83 QPMFTLIGGGMKRLDQSHRQMA------------DVLPTKAKWVKEKALEFDPDNNTVSTSGGKT 135
            .....|    .|.||....|:|            ::| |:|     :.:..|..|..|....|..
  Rat   232 YDRAKL----SKSLDAQPEQLALRPKEFFRAYGIEML-TEA-----QVVTVDVRNKKVVFKDGFK 286

  Fly   136 IKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCP 200
            ::|..|::|.      |..|..:........||.:|.:|:..:.|   ||.....||:       
  Rat   287 LEYSKLLLAP------GSSPKTLTCKGKDIENVFTIRTPEDANRV---LRLARGRNAV------- 335

  Fly   201 IKCAG--APQKIAYISEHYFRKMGRRDNVNIIYNTSLPV-IFGVKHYAEALMKLIKRRNITLNVQ 262
            :..||  ..:..||::|       :..:|:::.....|. .|..:....||||:.:...:...:|
  Rat   336 VVGAGFLGMEVAAYLTE-------KAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQ 393

  Fly   263 RNLVEVRH----------KDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTG 317
            ..:.|:|.          |.:..:..|:...|:      ..:..|..:....:..:.:      |
  Rat   394 TEVSELRAQEGKLQEVVLKSSKVLRADVCVVGI------GAVPATGFLRQSGIGLDSR------G 446

  Fly   318 FVDVDQLTLQHNKYSNVFAIGDSASSP-----NSKTA----AAAAAQSPVVFKNVMA-------- 365
            |:.|::: :|.| ...|||.||:.:.|     |.|..    ..|.||..|..:|::|        
  Rat   447 FIPVNKM-MQTN-IPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEINTV 509

  Fly   366 -----AIEGKAPTDIYDGYSSCPIVTGYSSCIL 393
                 |:.||:..  |.||..     |:...|:
  Rat   510 PYLWTAMFGKSLR--YAGYGE-----GFDDVII 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 64/307 (21%)
Aifm3XP_008767097.1 Rieske_AIFL_N 70..163 CDD:239560
Pyr_redox_2 194..492 CDD:400379 75/345 (22%)
Reductase_C 511..>561 CDD:405449 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.