DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and F20D6.11

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_505112.1 Gene:F20D6.11 / 179196 WormBaseID:WBGene00017640 Length:549 Species:Caenorhabditis elegans


Alignment Length:328 Identity:80/328 - (24%)
Similarity:137/328 - (41%) Gaps:69/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QECQ---VLVVGGGTGGCAMAAKLS-SRLGS--DKVVVLEPEDKHYY-------QPMFTLIGGGM 93
            ::|.   |:::|||.   |.|..:. |||..  ..::|:..|....|       :|..|  |..:
 Worm   139 KQCNDRPVVIIGGGV---ATATFIEHSRLNGLITPILVISEESLPPYDRVLLSKKPAAT--GEDI 198

  Fly    94 K-RLDQS---HRQMADVLPTKAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKI 154
            : |.|.:   .|.:..:|.|....|..|:.|       ||.|.|:|:.|..||||||        
 Worm   199 RLRKDDAFYEERNVKFLLKTSVIAVNHKSRE-------VSLSNGETVVYSKLIIATG-------- 248

  Fly   155 PGLVEALETPDS---NVCSIYSPKYVDHVYECLRRTNKGNAIFTF-PNCPIKCAGAPQKIAYISE 215
             |.|..|:.|.|   |:|             .||:..:.|.|... |...:.|.|:    ::|..
 Worm   249 -GNVRKLQVPGSDLKNIC-------------YLRKVEEANIISNLHPGKHVVCVGS----SFIGM 295

  Fly   216 HYFRKMGRR-DNVNIIYNTSLPV-IFGVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNIAVFE 278
            .....:..: .:|.:|.||..|: :|| ....:.:....:.:.:...:..|:|.:|..|...|.:
 Worm   296 EVASALAEKAASVTVISNTPEPLPVFG-SDIGKGIRLKFEEKGVKFELAANVVALRGNDQGEVSK 359

  Fly   279 DLAKPGVHYEETYSM--LHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNVFAIGDSA 341
            .:.:.|...:....:  :.|||  :|..:..:..|| ...||::||:....:..|  :||:||..
 Worm   360 VILENGKELDVDLLVCGIGVTP--ATKFLEGSGIKL-DNRGFIEVDEKFRTNISY--IFAMGDVV 419

  Fly   342 SSP 344
            ::|
 Worm   420 TAP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 73/304 (24%)
F20D6.11NP_505112.1 Rieske_AIFL_N 29..118 CDD:239560
Pyr_redox_2 147..443 CDD:369639 78/320 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.