DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14997 and AIFM3

DIOPT Version :9

Sequence 1:NP_647877.1 Gene:CG14997 / 38514 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001373743.1 Gene:AIFM3 / 150209 HGNCID:26398 Length:605 Species:Homo sapiens


Alignment Length:411 Identity:91/411 - (22%)
Similarity:148/411 - (36%) Gaps:134/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDKH--YYQPMFTLIGGGMKRLDQSHRQMA---- 104
            ||:||.|..|...|..|.....||: :||...|:|  |.:|..:      |.||....|:|    
Human   197 VLIVGAGAAGLVCAETLRQEGFSDR-IVLCTLDRHLPYDRPKLS------KSLDTQPEQLALRPK 254

  Fly   105 --------DVLPTKAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIATGLQLNYGKI---PGLV 158
                    :|| |:|:.|            ||.....|.:..|      |.:|.|.|:   ||  
Human   255 EFFRAYGIEVL-TEAQVV------------TVDVRTKKVVFKD------GFKLEYSKLLLAPG-- 298

  Fly   159 EALETPDS---------NVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGA----PQKI 210
               .:|.:         ||.:|.:|:..:.|....|..|            :...||    .:..
Human   299 ---SSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRN------------VVVVGAGFLGMEVA 348

  Fly   211 AYISEHYFRKMGRRDNVNIIYNTSLPV-IFGVKHYAEALMKLIKRRNITLNVQRNLVEVRH---- 270
            ||::|       :..:|:::.....|. .|..:....||||:.:...:...:|..:.|:|.    
Human   349 AYLTE-------KAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGK 406

  Fly   271 ------KDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHN 329
                  |.:..|..|:...|:      ..:..|..:....:..:.:      ||:.|::: :|.|
Human   407 LKEVVLKSSKVVRADVCVVGI------GAVPATGFLRQSGIGLDSR------GFIPVNKM-MQTN 458

  Fly   330 KYSNVFAIGDSASSP-----NSKTA----AAAAAQSPVVFKNVMA-------------AIEGKAP 372
             ...|||.||:.:.|     |.|..    ..|.||..|..:|::|             |:.||:.
Human   459 -VPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSL 522

  Fly   373 TDIYDGYSSCPIVTGYSSCIL 393
            .  |.||..     |:...|:
Human   523 R--YAGYGE-----GFDDVII 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 68/323 (21%)
AIFM3NP_001373743.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..45
Rieske_AIFL_N 70..164 CDD:239560
Pyr_redox_2 195..493 CDD:400379 79/359 (22%)
Reductase_C 512..>562 CDD:405449 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.