DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and KIRREL3

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:289 Identity:52/289 - (17%)
Similarity:96/289 - (33%) Gaps:95/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATI-- 76
            ::|.|.:.::|.        .:.::.:..|:..||   |....||:       |.:..:|||.  
Human   157 VILGGPVISLRA--------GDPLNLTCHADNAKP---AASIIWLR-------KGEVINGATYSK 203

  Fly    77 --------------------------EIVCEMMGSQVP-----SIQWVVGHLPRSEL-------- 102
                                      .|||......:|     |:...:.|.|...|        
Human   204 TLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVL 268

  Fly   103 -DDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEK 166
             |::.:...:.:|..|:.:.|.:. ...::.||          |..:|.:||.:...|..::.|.
Human   269 EDNVVTFHCSAKANPAVTQYRWAK-RGQIIKEA----------SGEVYRTTVDYTYFSEPVSCEV 322

  Fly   167 T--------------YPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQ 217
            |              |.|   ||:....::.|..:||:....|.....|...|.|:...:..::.
Human   323 TNALGSTNLSRTVDVYFG---PRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLS 384

  Fly   218 GHRHRVLANGDLLISEIKWEDMGNYKCIA 246
            ..:       .|.:..::.||.|.|.|.|
Human   385 NEK-------TLTLKSVRQEDAGKYVCRA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 13/60 (22%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352 18/109 (17%)
Ig2_KIRREL3-like 171..252 CDD:143236 15/90 (17%)
Ig_2 260..337 CDD:290606 14/87 (16%)
I-set 341..422 CDD:254352 16/73 (22%)
IGc2 355..406 CDD:197706 12/57 (21%)
Ig5_KIRREL3 424..521 CDD:143306
IG_like 432..521 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.