DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and KIRREL2

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:259 Identity:55/259 - (21%)
Similarity:91/259 - (35%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIV--------CEM 82
            |.|:|.|:::   ...:|.:...|:|..:...|    .||...|...|.::.:|        |..
Human    91 RPVELEDEAS---YECQATQAGLRSRPAQLHVL----VPPEAPQVLGGPSVSLVAGVPANLTCRS 148

  Fly    83 MGS--QVPSIQWV-VGHLPRSELDDLDSNQ--VAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGR 142
            .|.  ..|.:.|. .|.|    ||....:|  :.|..|.::....:.....|  .:..|:.|..|
Human   149 RGDARPTPELLWFRDGVL----LDGATFHQTLLKEGTPGSVESTLTLTPFSH--DDGATFVCRAR 207

  Fly   143 TGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEIT- 206
                    |..:...|.:.:|....||    |.:..:...|....|..:...|:..|:|  .:| 
Human   208 --------SQALPTGRDTAITLSLQYP----PEVTLSASPHTVQEGEKVIFLCQATAQP--PVTG 258

  Fly   207 --WLNNENKEI-VQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVG---KDTA-DTFVYPVL 263
              |....:..: .:|.|..|:|:...|...:        .|...|.||   :.|| |....|:|
Human   259 YRWAKGGSPVLGARGPRLEVVADASFLTEPV--------SCEVSNAVGSANRSTALDVLFGPIL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 13/67 (19%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 7/30 (23%)
IGc2 38..106 CDD:197706 4/17 (24%)
I-set 126..224 CDD:254352 21/111 (19%)
Ig2_KIRREL3-like 141..223 CDD:143236 18/95 (19%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 17/84 (20%)
IG_like 234..308 CDD:214653 18/83 (22%)
Ig 312..395 CDD:299845 2/3 (67%)
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.