Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996816.3 | Gene: | USH2A / 7399 | HGNCID: | 12601 | Length: | 5202 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 45/237 - (18%) |
---|---|---|---|
Similarity: | 70/237 - (29%) | Gaps: | 86/237 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 EKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQV 110
Fly 111 AEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTG-------SKTIYASTVVHPPRSSRLTPEKTY 168
Fly 169 PGAQK--------------PRIIYTEKTHLDLMGSNIQLPCRVHARPRAEIT-WLNNENKEIVQG 218
Fly 219 HRHRVLANGDLLISEIKW--EDMG-------NYKCIARNVVG 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 13/73 (18%) |
USH2A | NP_996816.3 | LamGL | 146..283 | CDD:214722 | |
Laminin_N | 291..516 | CDD:413488 | |||
EGF_Lam | 517..565 | CDD:238012 | |||
EGF_Lam | 574..639 | CDD:238012 | |||
Laminin_EGF | 641..691 | CDD:395007 | |||
EGF_Lam | 694..733 | CDD:214543 | |||
Laminin_EGF | 747..795 | CDD:395007 | |||
EGF_Lam | 794..844 | CDD:238012 | |||
EGF_Lam | 847..897 | CDD:214543 | |||
EGF_Lam | 900..948 | CDD:238012 | |||
EGF_Lam | 950..1000 | CDD:238012 | |||
EGF_Lam | 1001..>1037 | CDD:238012 | |||
fn3 | 1058..1132 | CDD:394996 | |||
fn3 | 1150..1227 | CDD:394996 | |||
FN3 | 1242..1357 | CDD:238020 | |||
FN3 | 1368..1451 | CDD:214495 | |||
LamG | 1519..1678 | CDD:238058 | |||
LamG | 1716..1868 | CDD:238058 | |||
FN3 | 1956..2051 | CDD:238020 | |||
FN3 | 2241..2313 | CDD:238020 | |||
FN3 | 2329..2428 | CDD:238020 | |||
FN3 | 2432..2528 | CDD:238020 | |||
FN3 | 2533..2619 | CDD:238020 | |||
FN3 | 2621..2719 | CDD:238020 | |||
FN3 | 2724..2799 | CDD:238020 | 18/95 (19%) | ||
FN3 | 2818..2920 | CDD:238020 | 21/120 (18%) | ||
FN3 | 2925..3015 | CDD:238020 | |||
FN3 | 3026..>3087 | CDD:238020 | |||
FN3 | <3449..3494 | CDD:238020 | |||
FN3 | 3503..3586 | CDD:238020 | |||
FN3 | 3590..3676 | CDD:238020 | |||
FN3 | 3680..3767 | CDD:238020 | |||
fn3 | 3777..3856 | CDD:394996 | |||
FN3 | 3866..3960 | CDD:238020 | |||
FN3 | 3964..4057 | CDD:238020 | |||
fn3 | 4161..4247 | CDD:394996 | |||
FN3 | 4268..4351 | CDD:238020 | |||
fn3 | 4357..4428 | CDD:394996 | |||
FN3 | 4444..4516 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 4518..4541 | ||||
FN3 | 4529..4627 | CDD:238020 | |||
FN3 | 4636..4730 | CDD:238020 | |||
FN3 | 4826..4927 | CDD:238020 | |||
PDZ-binding | 5200..5202 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |