DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:284 Identity:61/284 - (21%)
Similarity:105/284 - (36%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LHVCALALLLFGSIATVRGRAVDLVDDSNDVD-------NSIEAEEEKPR-----NRAFEADWLK 59
            :|....|:|...:....|...:.:..|.:|..       |::: ||::.|     |.........
  Fly    86 MHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQ-EEDRGRYMCQINTVTAKTQYG 149

  Fly    60 FTK--TPPT---KLQQAD-----GATIEIVCEMMGSQVPSIQW--------VVGHLPRSELDDLD 106
            |.|  .||.   .|..:|     |..:.:.|:..||..|:|:|        |:.  ...|:.||:
  Fly   150 FVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVIN--KTLEVHDLE 212

  Fly   107 SNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGA 171
            ::.:..|      |:...|:        ..|.|:         ||..|.|..|.|:.....:   
  Fly   213 TDSLELE------RISRLHM--------GAYLCI---------ASNGVPPSVSKRIKVSVDF--- 251

  Fly   172 QKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRV---------LANG 227
             .|.:....:.....:|.||.|.|.:.|.|.:...|....::.|.:..:::.         .|..
  Fly   252 -SPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATM 315

  Fly   228 DLLISEIKWEDMGNYKCIARNVVG 251
            .|.|:.::..|.|||||:|:|..|
  Fly   316 RLTITNVQSSDYGNYKCVAKNPRG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/72 (28%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 13/69 (19%)
Ig 69..139 CDD:143165 10/53 (19%)
IG_like 165..249 CDD:214653 23/108 (21%)
IGc2 172..237 CDD:197706 18/89 (20%)
IG_like 267..348 CDD:214653 21/73 (29%)
Ig 270..339 CDD:299845 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.