| Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
| Alignment Length: | 211 | Identity: | 44/211 - (20%) |
|---|---|---|---|
| Similarity: | 85/211 - (40%) | Gaps: | 35/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 KTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHI 126
Fly 127 IDHV---LSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMG 188
Fly 189 SNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRV-------LANGDLLISEIKWEDMGNYKCIA 246
Fly 247 RNVVGKDTADTFVYPV 262 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 18/70 (26%) |
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | |
| Ig | 145..238 | CDD:416386 | 21/106 (20%) | ||
| Ig strand A | 145..149 | CDD:409353 | |||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 2/10 (20%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 216..223 | CDD:409353 | 2/6 (33%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
| Ig | 242..333 | CDD:416386 | 21/91 (23%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 314..322 | CDD:409353 | 5/7 (71%) | ||
| Ig strand G | 325..334 | CDD:409353 | 1/8 (13%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||