DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and prtgb

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_005174269.3 Gene:prtgb / 572241 ZFINID:ZDB-GENE-060302-1 Length:1150 Species:Danio rerio


Alignment Length:210 Identity:46/210 - (21%)
Similarity:76/210 - (36%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELD----DLDSNQVAEEAPSAIVRVRSSH 125
            |..:..|....:.:.|...|:..|.:.|       |..|    |:.:..|.......|..|::.|
Zfish   227 PQNISVALHQPVVLECLAEGNPRPLVSW-------SRADSKPIDVSAASVLGNGNLMISAVKAHH 284

  Fly   126 IIDHVLSEARTYTCVGRTGSKTIYAS-----TVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLD 185
                    :.||.|...|.....|.:     ||:.||........:|.|.|...|          
Zfish   285 --------SGTYVCRATTPGTRNYTTAAGNVTVLLPPSLVEKPESQTRPRAGTAR---------- 331

  Fly   186 LMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVV 250
                   ..|:....|..:|||.  :|.|:::.:....:.|..|:|::|..||...|:|:|.|..
Zfish   332 -------FSCQAEGTPTPQITWF--KNGEVIRTNGRTKMYNNKLVITQIIPEDDAFYQCLAENSQ 387

  Fly   251 GKDTADTFVYPVLNE 265
            |...:.:.:..|.:|
Zfish   388 GSVVSTSRLIVVQSE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/63 (27%)
prtgbXP_005174269.3 Ig 31..118 CDD:325142
I-set 123..207 CDD:333254
Ig_3 220..293 CDD:316449 16/80 (20%)
I-set 313..398 CDD:254352 23/103 (22%)
FN3 405..498 CDD:238020
FN3 509..599 CDD:238020
FN3 608..687 CDD:238020
FN3 711..802 CDD:238020
FN3 809..899 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.