DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and igsf9ba

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:225 Identity:54/225 - (24%)
Similarity:82/225 - (36%) Gaps:56/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSS 124
            |:.|||..::..:|.:|.:.|...|:..|.:.|:      .|.|.|.|                 
Zfish   141 FSDTPPQYVEAREGGSITLTCTAFGNPKPVVTWL------REGDQLTS----------------- 182

  Fly   125 HIIDHVLSEARTYTCVGRTGSKTIYA---------STVVHPPRSSRLTPEKTYPGAQKPRIIYTE 180
                     .|.||.  ..||.|:.|         |...|..:...|...:..  .|.|..|.|.
Zfish   183 ---------TRKYTV--SDGSLTVQAITREDRGAYSCRAHSDQGEALHTTRLL--VQGPPYIVTP 234

  Fly   181 KTHLDL-MGSNIQLPCRVHARP-RAEITWLNNENKEIVQGH---RHRVLANGDLLISEIKWEDMG 240
            ..::.: :..|.|..|:..|.| ....||...|:....:..   |.|:..:|.|:|..:|.||.|
Zfish   235 PENITVNISQNAQFTCQAEAYPGNLTYTWYWEEDNVYFKNDLKLRVRIFIDGTLIIYRVKPEDAG 299

  Fly   241 NYKCIARNVVG-KDTADTFV---YP--VLN 264
            .|.|...|.:| ..:|..::   ||  |:|
Zfish   300 KYTCSPSNSLGISPSASAYLTVQYPARVVN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/67 (30%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352 24/119 (20%)
I-set 229..321 CDD:333254 24/91 (26%)
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.