DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and chl1a

DIOPT Version :10

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_068072887.1 Gene:chl1a / 566148 ZFINID:ZDB-GENE-090313-201 Length:1310 Species:Danio rerio


Alignment Length:269 Identity:66/269 - (24%)
Similarity:108/269 - (40%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FGSIATV-------RGRAVDLVDDSNDVD-NSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQA-D 72
            ||.:.|:       .|:.:....:.:..| :..:.|.|:|      ..|.|    .|.|.|.| .
Zfish   294 FGKLLTIPNIREEDEGKYMCKAKNQHGEDVHHFQVEVEEP------PSWQK----EPLKSQLAWI 348

  Fly    73 GATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQ-----------VAEEAPSAIVRVRSSHI 126
            |:.|.|.|...|...|:|.|.....|   |||..|..           .||:..:|:.:..:|: 
Zfish   349 GSDIHINCSATGKPQPTITWKRNGKP---LDDFPSTHHKMLDDRIIILKAEQKDTAVYQCEASN- 409

  Fly   127 IDHVLSEARTYTCVGRTGSKTIYASTVV--HPPRSSRLTPEKTYPGAQKPRIIYTEKTHLD---L 186
                           :.||....|:.:|  |||                  :|.| :.:|:   :
Zfish   410 ---------------KHGSLLANANVLVMNHPP------------------LILT-RNYLEYATM 440

  Fly   187 MGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVG 251
            :|.::.:.|.|.:.|.|.:.|...:.:..|.|.|:.:|.||.|.|.:::.||||.|||:|.|..|
Zfish   441 LGKSVIMDCNVFSSPPATLNWRREDPEGSVDGERYSLLKNGSLQIHKVEMEDMGQYKCLANNSEG 505

  Fly   252 KDTADTFVY 260
            ..:..|.::
Zfish   506 TASITTELF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 PHA02785 <74..246 CDD:165149 47/187 (25%)
Ig_3 173..248 CDD:464046 25/77 (32%)
chl1aXP_068072887.1 Ig 32..125 CDD:472250
Ig strand B 51..55 CDD:409396
Ig strand C 64..68 CDD:409396
Ig strand E 89..93 CDD:409396
Ig strand F 105..110 CDD:409396
Ig strand G 119..122 CDD:409396
Ig 134..224 CDD:472250
Ig strand B 148..152 CDD:409432
Ig strand C 162..166 CDD:409432
Ig strand E 185..189 CDD:409432
Ig strand F 200..205 CDD:409432
Ig strand G 216..219 CDD:409432
Ig 250..331 CDD:472250 6/36 (17%)
Ig strand B 262..266 CDD:409394
Ig strand C 275..279 CDD:409394
Ig strand E 296..300 CDD:409394 0/3 (0%)
Ig strand F 310..315 CDD:409394 0/4 (0%)
Ig strand G 323..326 CDD:409394 0/2 (0%)
Ig 336..422 CDD:472250 26/108 (24%)
Ig strand B 352..356 CDD:409367 2/3 (67%)
Ig strand C 365..369 CDD:409367 1/3 (33%)
Ig strand E 389..393 CDD:409367 0/3 (0%)
Ig strand F 402..407 CDD:409367 0/4 (0%)
Ig strand G 415..418 CDD:409367 0/2 (0%)
Ig 429..513 CDD:472250 28/84 (33%)
Ig strand B 445..449 CDD:409544 0/3 (0%)
Ig strand C 458..462 CDD:409544 0/3 (0%)
Ig strand E 481..485 CDD:409544 2/3 (67%)
Ig strand F 495..500 CDD:409544 3/4 (75%)
Ig strand G 508..511 CDD:409544 0/2 (0%)
Ig 517..617 CDD:472250
Ig strand B 536..540 CDD:409359
Ig strand C 553..557 CDD:409359
Ig strand E 576..580 CDD:409359
Ig strand F 590..595 CDD:409359
Ig strand G 603..606 CDD:409359
FN3 614..703 CDD:238020
fn3 717..797 CDD:394996
FN3 <783..1099 CDD:442628
FN3 1092..1172 CDD:238020
Bravo_FIGEY 1209..1290 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.