DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and robo4

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:270 Identity:61/270 - (22%)
Similarity:98/270 - (36%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAKMNLHVCALALLLFGSIATVRGR------AVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLK 59
            |:|:....|.....|.|.|:  |.||      ||......|.:.|:..      ||.:.....|:
Zfish   116 MDAQSQPIVLPDGSLFFFSV--VPGRKGQSHEAVYACIAHNSIGNATS------RNASLHIAALR 172

  Fly    60 FT-KTPPTKLQQADGATIEIVCE-MMGSQVPSIQWVVGHLPRSELDDL---DSNQVAEEAPSAIV 119
            .. :..|:.::.|.|....|.|. .:|...|::.|        ..|.:   .||:...|....::
Zfish   173 EDFRVQPSDVEVAIGEMATINCSPPVGHPEPNVTW--------RKDGILINSSNEHYTELKGKLI 229

  Fly   120 RVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTV--VHPPRSSRLTPEKTYPGAQKPRIIYTEKT 182
                  |.....:::..|:|:         ||.:  |...|::||:........:||..:..:  
Zfish   230 ------IAPAQKNDSGVYSCI---------ASNMIGVRESRAARLSVLAKPVLLRKPEDVSVQ-- 277

  Fly   183 HLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGD--LLISEIKWEDMGNYKCI 245
                :|.:.|..|.....|...|.| :.|...:..|   |.|.|.|  |.|..:..:|||.|.|.
Zfish   278 ----LGESAQFFCEADGDPMPSIEW-SREQGPLPNG---RYLINPDHSLQIHYVTAQDMGRYSCT 334

  Fly   246 ARNVVGKDTA 255
            ..|.:|...|
Zfish   335 VENKLGVSVA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/65 (31%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 15/60 (25%)
I-set 71..168 CDD:254352 15/59 (25%)
I-set 175..261 CDD:254352 21/108 (19%)
Ig2_Robo 177..261 CDD:143201 21/106 (20%)
I-set 265..350 CDD:254352 24/90 (27%)
Ig 282..350 CDD:299845 21/67 (31%)
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.