DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and lrit1a

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:244 Identity:43/244 - (17%)
Similarity:78/244 - (31%) Gaps:76/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GSQVPSIQW-VVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYT--------- 138
            |:.:.|..| .:..:|...|.|:.:||::.....|.:.:::...:|  ||.....|         
Zfish   116 GNSLSSFPWESLMDMPSLRLLDIHNNQLSSLPSEAALYMKNITYLD--LSSNNLLTVPAEVLNTW 178

  Fly   139 -----CVGRTGSKTIY-----------------------ASTVVHPPRSSRLTPEKTYPG----- 170
                 .:|...||.|.                       :.:|.......|....::..|     
Zfish   179 LTIKPTLGAESSKLILGLHDNPWLCDCRLYDLVQFQKSPSLSVAFIDTRLRCADPESLSGVLFSD 243

  Fly   171 -----AQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLANGDLL 230
                 .|.||:..........:|:|:.|.|.....|..|:.|...:.|.:          ||.:|
Zfish   244 AELRRCQGPRVHTAVARVRSAVGNNVLLRCGTVGVPIPELAWRRADGKPL----------NGTVL 298

  Fly   231 ISE--------------IKWEDMGNYKCIARNVVGKDTADTFVYPVLNE 265
            :..              :.:.|.|.|.|.|.|..|  :|:..:..::|:
Zfish   299 LENSKEGIVWSILSVPAVSYRDTGKYICKATNYAG--SAEAVISLIIND 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/77 (22%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378
LRR_8 63..119 CDD:290566 1/2 (50%)
LRR_RI <77..175 CDD:238064 13/60 (22%)
leucine-rich repeat 85..108 CDD:275378
LRR_8 108..167 CDD:290566 12/52 (23%)
leucine-rich repeat 109..132 CDD:275378 3/15 (20%)
leucine-rich repeat 133..156 CDD:275378 5/22 (23%)
leucine-rich repeat 157..170 CDD:275378 3/14 (21%)
LRRCT 199..243 CDD:214507 3/43 (7%)
I-set 252..343 CDD:254352 21/102 (21%)
Ig 259..333 CDD:299845 17/83 (20%)
fn3 448..515 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.