DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr12

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:107/318 - (33%) Gaps:117/318 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LHVCALALLLF---------------GSIAT--------VRGRAVDLVDDSNDVDNSIEAEEEKP 48
            ||:..|.:||.               .||.|        :||.    ::..:.:||::::.:   
  Fly    16 LHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGG----INGDSKLDNNLDSSD--- 73

  Fly    49 RNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEE 113
             :..||...|....| ..:|    |.|..:||::.|.....:.|               ||:   
  Fly    74 -SPMFEDSELMAHNT-TVQL----GGTAFLVCKVSGVDRVGVNW---------------NQI--- 114

  Fly   114 APSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPE------------- 165
               :.:|.|..||:.   |.|:.||...|        ..::|.|.|:..|.:             
  Fly   115 ---SWIRRRDWHILS---SGAQLYTNDER--------FAILHTPGSNMWTLQIKFVQRRDHGMYE 165

  Fly   166 ---KTYPG-----------AQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE--ITWLNNENK- 213
               .|..|           ..:..|:.:.:.|:| |||.|.|.|.:...|...  :.|..|:.. 
  Fly   166 CQVSTPTGIISHFVNLQVVVPEAFILGSGELHVD-MGSTINLVCIIEKSPTPPQYVYWQKNDRLI 229

  Fly   214 -----------EIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFVY 260
                       |...|.|    ....|:|.|.:..|.|||.|.|.|.   :.|..:|:
  Fly   230 NYVDSRRDITIETTPGPR----TQSRLIIREPQVTDSGNYTCSASNT---EPASIYVF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 22/77 (29%)
dpr12NP_652462.3 IG 86..183 CDD:214652 25/133 (19%)
Ig_3 193..271 CDD:404760 23/82 (28%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.