DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and NCAM2

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:206 Identity:49/206 - (23%)
Similarity:83/206 - (40%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDH 129
            |.:.:|.:.|  |:||.:..|..|::.|:..:   .|:..:..|:.|..|.:.:      .|::.
Human   148 PQEFKQGEDA--EVVCRVSSSPAPAVSWLYHN---EEVTTISDNRFAMLANNNL------QILNI 201

  Fly   130 VLSEARTYTCVGRTGSK--TIYASTVV---HPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGS 189
            ..|:...|.|.||..::  ..:...:|   .||..|  .|:|::....:             .|.
Human   202 NKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIS--MPQKSFNATAE-------------RGE 251

  Fly   190 NIQLPCRVHARPRAEITWLNN-----EN-KEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARN 248
            .:...||....|...|:|..|     || |.|::|      :|.:|.:..|...|.|.|.|.|.|
Human   252 EMTFSCRASGSPEPAISWFRNGKLIEENEKYILKG------SNTELTVRNIINSDGGPYVCRATN 310

  Fly   249 VVGKDTADTFV 259
            ..|:|....|:
Human   311 KAGEDEKQAFL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/69 (30%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352 19/80 (24%)
IGc2 153..214 CDD:197706 16/71 (23%)
Ig 233..326 CDD:299845 29/110 (26%)
I-set 240..323 CDD:254352 25/101 (25%)
Ig5_NCAM-2 325..422 CDD:143278
IG_like 333..420 CDD:214653
IG_like 438..515 CDD:214653
IGc2 439..507 CDD:197706
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.