DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and NCAM1

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:304 Identity:74/304 - (24%)
Similarity:111/304 - (36%) Gaps:97/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDSND-----VDNSIEAE----EEKPRNRAFEAD---WLK-FTKTPPTKLQQADGATIE----IV 79
            |||:.     ||.:.|||    .|   |:|.|.|   .|| |.|...|.::......:|    :.
Human   267 DDSSQLTIKKVDKNDEAEYICIAE---NKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLT 328

  Fly    80 CEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAE----------------------EAPSA----- 117
            ||..|..:|||.|      |:...::.|.:.|.                      :|.||     
Human   329 CEASGDPIPSITW------RTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGS 387

  Fly   118 ------IVRVRSSHIIDHVLSEARTYTCVGR---TGSKTIYASTVVHPPRSSRLTPEKTY-PGAQ 172
                  .:.|||...:..:..::..||..|.   |.|.||...       |..:..|..| |..|
Human   388 HETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQD-------SQSMYLEVQYAPKLQ 445

  Fly   173 KPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWL---------NNENKEIVQGHRHRVLANGD 228
            .|..:||.:      |:.:.:.|.|.|.|.|.|:|.         |..|.:|     :...:...
Human   446 GPVAVYTWE------GNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKI-----YNTPSASY 499

  Fly   229 LLISEIKWEDMGNYKCIARNVVGKDT-------ADTFVYPVLNE 265
            |.::.....|.|||.|.|.|.:|:::       |||...|.:::
Human   500 LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQ 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/72 (26%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig 211..307 CDD:325142 16/42 (38%)
Ig 306..438 CDD:325142 27/144 (19%)
Ig_3 447..519 CDD:316449 21/82 (26%)
FN3 534..631 CDD:238020 3/10 (30%)
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.