DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and tutl

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:234 Identity:51/234 - (21%)
Similarity:89/234 - (38%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DDSN----DVDNSIEAEEEKPRNRAFEADWLKFTKTP-----PTKLQQADGATIEIVCEMMGSQV 87
            |||.    :|.|.|...:......:.|.. .|.|.||     |.:|...      :.|.:..|  
  Fly   412 DDSGQYLCEVTNGIGDPQSASAYLSVEYP-AKVTFTPTVQYLPFRLAGV------VQCYIKSS-- 467

  Fly    88 PSIQWVVGHLPRSELDDLDSNQVAEEAPSAIV--RVRSSHIIDHVLSEARTYTCVGRTGSKTIYA 150
            |.:|:|.....:..|:......:...|..:::  ||...|...:..:   .|...|..|:..:..
  Fly   468 PQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQYACT---PYNAQGTAGASGVMD 529

  Fly   151 STVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPC---RVHARPRAEITWLNNEN 212
            ..|..||   ..|.|        |..:|..|     :|.::::.|   ......|..|.|...|.
  Fly   530 VLVRKPP---AFTVE--------PETLYQRK-----VGDSVEMHCDALEAEGTERPTIKWQRQEG 578

  Fly   213 KEIVQGHRHRV-LANGDLLISEIKWEDMGNYKCIARNVV 250
            :::.:..|:|: ::.|::.|..::.||.|.|:|:..|.|
  Fly   579 EQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEV 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/68 (25%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 6/24 (25%)
Ig 349..437 CDD:299845 6/24 (25%)
Ig 459..530 CDD:299845 13/81 (16%)
IG_like 549..628 CDD:214653 18/74 (24%)
IGc2 551..617 CDD:197706 16/65 (25%)
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.