DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and opcml

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:205 Identity:46/205 - (22%)
Similarity:74/205 - (36%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHV 130
            |.:...:|:.:.::|..:|...|||.|                           :.|||. .:.:
Zfish   140 TDVSVNEGSNVSLMCLAIGRPEPSILW---------------------------KFRSSK-GNRI 176

  Fly   131 LSEARTYTCVGRT----GSKTIYASTVVHPP--RSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGS 189
            ::|.......|.|    ||.....|..:.||  |:.::|       ...|.:|...::....:|.
Zfish   177 VTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVT-------VNYPPVISRARSTGTAVGQ 234

  Fly   190 NIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLAN----GDLLISEIKWEDMGNYKCIARNVV 250
            ...|.|...|.|.|:..|...| :.|:.|.....:.|    ..|....:..||.|||.|:|.|.:
Zfish   235 KGVLWCEASAVPLADFQWFKGE-RRILNGFNGVKIENKGKQSMLTFFNVSEEDYGNYTCVAINTL 298

  Fly   251 GKDTADTFVY 260
            |...|...:|
Zfish   299 GITNASIILY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/67 (30%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845
IG_like 41..129 CDD:214653
IG_like 139..216 CDD:214653 21/110 (19%)
IGc2 146..202 CDD:197706 15/83 (18%)
I-set 219..307 CDD:254352 24/88 (27%)
ig 223..307 CDD:278476 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.