DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and negr1

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:220 Identity:48/220 - (21%)
Similarity:75/220 - (34%) Gaps:58/220 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KTPP------TKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVR 120
            |.||      :.:...:|:.:.::|...|...|.|.|  .|:                :|||  |
Zfish   137 KVPPKIYDISSDITVNEGSNVSLICAASGKPEPKISW--RHI----------------SPSA--R 181

  Fly   121 VRSS----HIIDHVLSEARTYTC-----VGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRI 176
            ...|    :|......:|..|.|     :....:||:.. ||..||                  .
Zfish   182 KYESGEYLNITGISRDQAGDYECGAENDIASPDTKTVRV-TVNFPP------------------A 227

  Fly   177 IYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHR---HRVLANGDLLISEIKWED 238
            |:..|:|....|....|.|...|.|.....|...| |.|..|..   :.:.:...|.:..:..:.
Zfish   228 IHEMKSHGVRPGQVALLRCEAAAVPSPVFEWYKGE-KRINMGQGIVINNLSSRSVLTVKNMTQDR 291

  Fly   239 MGNYKCIARNVVGKDTADTFVYPVL 263
            .|||.|:|.|.:|...|...:.|::
Zfish   292 YGNYTCVAVNRLGTANASVPLNPII 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/66 (26%)
negr1XP_009300786.1 Ig 42..121 CDD:299845
IG_like 44..136 CDD:214653
I-set 140..222 CDD:254352 19/102 (19%)
IGc2 153..208 CDD:197706 16/74 (22%)
IG_like 236..312 CDD:214653 19/76 (25%)
IGc2 238..304 CDD:197706 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.