DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:231 Identity:44/231 - (19%)
Similarity:87/231 - (37%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSA--IVRVRSSH----- 125
            :|:.:.||  :.|:..|:..|.:.|      |.|    |...:....|.:  :::|.|.:     
  Fly   154 VQEGEDAT--LTCKATGNPQPRVTW------RRE----DGEMILIRKPGSRELMKVESYNGSSLR 206

  Fly   126 IIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTY-PGAQKP-RIIYTEKTHLDLMG 188
            ::.....:...|.|:         ||..|.|..|.|::....: |..:.| :::.|.      :|
  Fly   207 LLRLERRQMGAYLCI---------ASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTP------LG 256

  Fly   189 SNIQLPCRVHARPRAEITWLNNEN--------------------KEIVQGHRHRVLANGD----- 228
            |::||.|:|.|.|.....||....                    :.::.|.::.:....|     
  Fly   257 SDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERRDGYRGV 321

  Fly   229 --LLISEIKWEDMGNYKCIARNVVGKDTADTFVYPV 262
              |::......|:|.|.|::.|.:|:......:|.:
  Fly   322 MLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/90 (20%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653
Ig 47..129 CDD:299845
Ig 140..238 CDD:299845 21/104 (20%)
IG_like 247..355 CDD:214653 21/113 (19%)
Ig 256..351 CDD:299845 19/94 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.