DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and klg

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:277 Identity:65/277 - (23%)
Similarity:101/277 - (36%) Gaps:86/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWL-----KFTK---------TP 64
            :|...:|...|...|.|:|..|     :|..:.:|::   ..|::     |..:         .|
  Fly   140 VLTASNIMVTRDERVRLIDGYN-----LEISDLEPQD---AGDYVCQISDKINRDQVHTVEILVP 196

  Fly    65 PT--------KLQQADGATIEIVCEMMGSQVPSIQWV-----------VGHLPRSELDDLDSNQV 110
            |:        :||...|..|.:.|:..|:.||||.|.           :|..|...|:.|:..| 
  Fly   197 PSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQ- 260

  Fly   111 AEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPR 175
                                   |..|.|....|         |..|.:..:..:..||..    
  Fly   261 -----------------------AGVYQCTADNG---------VGDPVTVDMRLDVLYPPD---- 289

  Fly   176 IIYTEKTHLDL-MGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVL---ANGDLL-ISEIK 235
             |..||:.:.. .|...:|.|.|.|.|.|.::|.  :|...:|....|::   ||..:| |..|:
  Fly   290 -IQVEKSWIHSGEGFEAKLVCIVFADPVATVSWY--QNSFPIQSTDRRIMATRANRHMLTIRHIQ 351

  Fly   236 WEDMGNYKCIARNVVGK 252
            .||.|||.|:|.|.:|:
  Fly   352 QEDFGNYSCVADNSLGR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 24/67 (36%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518
IG_like 109..195 CDD:214653 11/62 (18%)
Ig 118..191 CDD:143165 11/58 (19%)
IG_like 205..274 CDD:214653 21/101 (21%)
IGc2 213..273 CDD:197706 18/92 (20%)
IGc2 301..367 CDD:197706 24/67 (36%)
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.