DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr17

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:189 Identity:42/189 - (22%)
Similarity:60/189 - (31%) Gaps:69/189 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EAPSAIVRVRSSHII-------------------DHVL-----------SEARTYTCVGRTGSKT 147
            :.|.:.||:|.:|||                   ||..           |:|..|.|...|..| 
  Fly   434 DKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGWYECQMATEPK- 497

  Fly   148 IYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHAR--PRAEITWLNN 210
              .|..||    .::...||.....:.|.:..        ||.:.|.|.|...  |...|.|...
  Fly   498 --LSAKVH----LQIVKPKTELIGDQSRFVKA--------GSKVALHCIVRGTLDPPKYIIWFRG 548

  Fly   211 ENK-------------------EIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVV 250
            :.|                   ..|..:::.:   |.|:|..::.||.|||.|...|.|
  Fly   549 QKKISDSDERTGWYTQLDRNIFGTVGDNQNTI---GSLIIPLVRKEDSGNYTCQPSNSV 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 21/85 (25%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 12/56 (21%)
Ig 415..507 CDD:299845 18/79 (23%)
IG_like 521..612 CDD:214653 21/95 (22%)
IGc2 524..605 CDD:197706 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.