Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287169.1 | Gene: | dpr16 / 40619 | FlyBaseID: | FBgn0037295 | Length: | 488 | Species: | Drosophila melanogaster |
Alignment Length: | 242 | Identity: | 49/242 - (20%) |
---|---|---|---|
Similarity: | 76/242 - (31%) | Gaps: | 90/242 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 LPRSELDDLDSN---QVAEEA------------PSAIVRVRSSHII--DHV--LSEARTYTCVGR 142
Fly 143 TGSKTIYA----STVVHPPRSSRLTPEKTYPGAQ------------------------------- 172
Fly 173 KPRI-------IYTEKTHL--DLM-----GSNIQLPCRVHA---RPR------------------ 202
Fly 203 -AEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARN 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 18/89 (20%) |
dpr16 | NP_001287169.1 | IG_like | 205..337 | CDD:214653 | 23/131 (18%) |
Ig | <298..338 | CDD:299845 | 1/39 (3%) | ||
IG_like | 352..447 | CDD:214653 | 18/86 (21%) | ||
Ig | 358..439 | CDD:143165 | 16/80 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |