DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr16

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:242 Identity:49/242 - (20%)
Similarity:76/242 - (31%) Gaps:90/242 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LPRSELDDLDSN---QVAEEA------------PSAIVRVRSSHII--DHV--LSEARTYTCVGR 142
            |||.:|.....|   |..:.|            |.:.||:|..|||  ||.  :::||..:.:..
  Fly   196 LPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQS 260

  Fly   143 TGSKTIYA----STVVHPPRSSRLTPEKTYPGAQ------------------------------- 172
            |...|:.:    ||...|..:...:.....||.|                               
  Fly   261 TTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLAT 325

  Fly   173 KPRI-------IYTEKTHL--DLM-----GSNIQLPCRVHA---RPR------------------ 202
            :|::       :.|.:|.|  |..     ||.::|.|.|..   .|:                  
  Fly   326 EPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEAS 390

  Fly   203 -AEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARN 248
             |:..|....::.|.....|.....|.|:|..::....|||.|...|
  Fly   391 GAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPEN 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 18/89 (20%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 23/131 (18%)
Ig <298..338 CDD:299845 1/39 (3%)
IG_like 352..447 CDD:214653 18/86 (21%)
Ig 358..439 CDD:143165 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.