DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and LSAMP

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:215 Identity:55/215 - (25%)
Similarity:79/215 - (36%) Gaps:60/215 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LQQADGATIEIVCEMMGSQVPSIQWV-------VGH-----LPRSELDDLDSNQVAEEAPSAIVR 120
            ::|.|.|.:..|.|...|:|   .|:       .||     .||.||:...|.:.:       :|
Human    43 VRQGDTAILRCVVEDKNSKV---AWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYS-------LR 97

  Fly   121 VRSSHIIDHVLSEARTYTCVGRT--GSKTIYASTVVH-PPRSSRLTPEKTYPGAQKPRIIYTEKT 182
            ::...:.|.     .:|||..:|  ..||.....:|. ||:.|.::.:.|..             
Human    98 IQKVDVYDE-----GSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVN------------- 144

  Fly   183 HLDLMGSNIQLPCRVHARPRAEITW--LNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCI 245
                .|||:.|.|..:.||...|||  |....:|. :|....      |.|..|..|..|.|:|.
Human   145 ----EGSNVTLVCMANGRPEPVITWRHLTPTGREF-EGEEEY------LEILGITREQSGKYECK 198

  Fly   246 ARNVVG----KDTADTFVYP 261
            |.|.|.    |....|..||
Human   199 AANEVSSADVKQVKVTVNYP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 22/65 (34%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 23/99 (23%)
Ig 132..215 CDD:386229 27/106 (25%)
Ig_3 219..294 CDD:372822 55/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.