Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305844.1 | Gene: | LSAMP / 4045 | HGNCID: | 6705 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 55/215 - (25%) |
---|---|---|---|
Similarity: | 79/215 - (36%) | Gaps: | 60/215 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 LQQADGATIEIVCEMMGSQVPSIQWV-------VGH-----LPRSELDDLDSNQVAEEAPSAIVR 120
Fly 121 VRSSHIIDHVLSEARTYTCVGRT--GSKTIYASTVVH-PPRSSRLTPEKTYPGAQKPRIIYTEKT 182
Fly 183 HLDLMGSNIQLPCRVHARPRAEITW--LNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCI 245
Fly 246 ARNVVG----KDTADTFVYP 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | 22/65 (34%) |
LSAMP | NP_001305844.1 | Ig | 38..128 | CDD:386229 | 23/99 (23%) |
Ig | 132..215 | CDD:386229 | 27/106 (25%) | ||
Ig_3 | 219..294 | CDD:372822 | 55/215 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |