DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr10

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:158 Identity:36/158 - (22%)
Similarity:54/158 - (34%) Gaps:42/158 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YTCVGRTGSKTIYASTVV----HPPRSSRLT--PEKTYPGAQKPRIIYTEKTH----LDLMGSNI 191
            :.|:  ||....|....|    |....::.|  |...||...|....|.:.|.    ..|:|.:.
  Fly     9 FCCL--TGLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSA 71

  Fly   192 QLPCRVHARPRAEITWLNNENKEIV-------------QGHRHRVLANGDLLISEIKW---EDMG 240
            .|.|||.......:.|:.:.:..|:             |...||.:....|   :|||   .|.|
  Fly    72 YLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTL---QIKWAQQRDAG 133

  Fly   241 NYKC-----------IARNVVGKDTADT 257
            .|:|           :..|:|....|:|
  Fly   134 VYECQISTQPVRSYSVNLNIVDLIDAET 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 19/90 (21%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/82 (23%)
IG_like 210..297 CDD:214653
IGc2 217..287 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.