DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and dpr13

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:84/244 - (34%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VDNSIEAEEEKPRNRAFEADWLKFTKTP-------PTKLQQADGATIEIVCEM--MGSQVPSIQW 92
            |:|.:||      |...|........||       .|.:....|||..:.|.:  :|..|  :.|
  Fly   153 VENHLEA------NNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGV--VSW 209

  Fly    93 VVG---HLPRSELDDLDSNQVAEEAPSAIVRVRSSHI---------IDHV-LSEARTYTCVGRTG 144
            :..   ||....|....|::          |..::|:         |..| |.:|..|.|...| 
  Fly   210 IRKKDYHLLTVGLTTYSSDE----------RFSATHLKHSEDWTLQIKFVQLRDAGVYECQVST- 263

  Fly   145 SKTIYASTVVHPPRS--SRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE--I 205
                      |||.|  ..|:..:.......|.|.|...      ||.::|.|||.....|.  |
  Fly   264 ----------HPPTSIFLHLSVVEARAEITGPPIRYLTP------GSTLRLQCRVVQNTEASEYI 312

  Fly   206 TWLNNE---NKEIVQG---HRHRVLANGDLLISEIKWEDMGNYKCIARN 248
            .|.::.   |.:|.:|   .......:.:|.|...:.|..||:.|:|.|
  Fly   313 FWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/70 (29%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 26/118 (22%)
IG_like 182..262 CDD:214653 20/91 (22%)
IG_like 285..362 CDD:214653 23/83 (28%)
IGc2 292..361 CDD:197706 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.