DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and Dscam2

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:226 Identity:57/226 - (25%)
Similarity:77/226 - (34%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KPRNRAFEAD-WLKFTKTPPTKLQQ------ADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDD 104
            :|....|:|. .|:....||..|..      ..|..:.:.|...|:..|.|.|.:...|      
  Fly   404 RPEGDTFQATAELQLGDAPPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFP------ 462

  Fly   105 LDSN------QVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVVHPPRSS--- 160
            |.||      |........|..|..||:   ::.:...|.|:...     .|..|.|..|.:   
  Fly   463 LPSNGRFMIGQYITVHGDVISHVNISHV---MVEDGGEYACIAEN-----RAGRVQHAARLNIYG 519

  Fly   161 ----RLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRH 221
                ||.|:.|                 .:.|..:.|.|.|...|..||.| ....:|:....|.
  Fly   520 LPYIRLIPKVT-----------------AVSGETLNLKCPVAGYPIEEIHW-ERGGRELPDDIRQ 566

  Fly   222 RVLANGDLLISEI-KWEDMGNYKCIARNVVG 251
            ||..:|.|.||.: |..|.|.|.|.|||..|
  Fly   567 RVQPDGSLTISPVQKNSDSGVYTCWARNKQG 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 24/64 (38%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352 4/13 (31%)
IGc2 344..407 CDD:197706 1/2 (50%)
IG_like 432..517 CDD:214653 21/98 (21%)
IGc2 436..507 CDD:197706 17/84 (20%)
I-set 521..610 CDD:254352 29/95 (31%)
IGc2 533..597 CDD:197706 24/64 (38%)
Ig 630..699 CDD:143165
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.