DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and babos

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:200 Identity:46/200 - (23%)
Similarity:80/200 - (40%) Gaps:58/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIE---AEEEKPRNRAFEADWLKFTK 62
            |.::.:|.:..| ||:.||.|.:......:.||....|:..:   .::..|..:         ||
  Fly     1 MMSRTDLLIAGL-LLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSPQ---------TK 55

  Fly    63 TP-PTKLQQAD---------GATIEIVCEMMGSQVPS----IQWVVGH----------LPRSELD 103
            :| |...::.:         |..:.:.|: :||.:.|    :.|..|.          .|..:||
  Fly    56 SPNPVASEKINKTLSVTGIRGEDVVLKCD-VGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLD 119

  Fly   104 ---DLD----SNQVA-----EEAPS-AIVRVR---SSHIIDHVLSEARTYTCVGRTGS---KTIY 149
               ||.    |.|||     :..|| ::|..:   :.|.:|.:..|:.| :..|...|   .|:.
  Fly   120 ANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIAPESST-SAAGSASSFLGCTVL 183

  Fly   150 ASTVV 154
            ||||:
  Fly   184 ASTVL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706
babosNP_001286719.1 ig 70..154 CDD:278476 19/84 (23%)
IG_like 70..154 CDD:214653 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.