Sequence 1: | NP_728961.2 | Gene: | ImpL2 / 38513 | FlyBaseID: | FBgn0001257 | Length: | 267 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286719.1 | Gene: | babos / 37557 | FlyBaseID: | FBgn0034724 | Length: | 196 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 80/200 - (40%) | Gaps: | 58/200 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEAKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIE---AEEEKPRNRAFEADWLKFTK 62
Fly 63 TP-PTKLQQAD---------GATIEIVCEMMGSQVPS----IQWVVGH----------LPRSELD 103
Fly 104 ---DLD----SNQVA-----EEAPS-AIVRVR---SSHIIDHVLSEARTYTCVGRTGS---KTIY 149
Fly 150 ASTVV 154 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ImpL2 | NP_728961.2 | IGc2 | 187..251 | CDD:197706 | |
babos | NP_001286719.1 | ig | 70..154 | CDD:278476 | 19/84 (23%) |
IG_like | 70..154 | CDD:214653 | 19/84 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |