DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ImpL2 and CG13506

DIOPT Version :9

Sequence 1:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:247 Identity:46/247 - (18%)
Similarity:86/247 - (34%) Gaps:70/247 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPS 89
            |..:.::.|..|:.:         |::.|               :|.|...:|  |........:
  Fly   161 GARLSILCDDRDITD---------RSQTF---------------RQGDHHKLE--CRTYLPDNAT 199

  Fly    90 IQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHV-LSEARTYTCVGRTGSKTIYASTV 153
            |:|        ..:||:..      ||::.......|:|:| ...|..|.|:...||:       
  Fly   200 IKW--------SFNDLNGQ------PSSVDNQNGVIILDNVDEKNAGDYQCLADDGSR------- 243

  Fly   154 VHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDL-MGSNIQLPCRVHARPRAEITWLNNEN----- 212
             |||..:      .:...|...|:.|.:.:::. .|:..:|.|...|:|.....::.:..     
  Fly   244 -HPPHGT------VHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLS 301

  Fly   213 -----KEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADTFV 259
                 |:.|....:|.    .|::.|:...|:|.|.|...|.:|.:.....|
  Fly   302 DKYSLKDSVHNDHNRT----TLIVREVTDSDLGEYLCQVENAIGSNEVKVHV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 15/73 (21%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653
IGc2 83..146 CDD:197706
IG_like 176..254 CDD:214653 23/122 (19%)
Ig 176..239 CDD:299845 18/93 (19%)
I-set 258..349 CDD:254352 18/94 (19%)
Ig 275..348 CDD:143165 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.